Align NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized)
to candidate WP_110804905.1 C8J30_RS06530 amino acid ABC transporter permease
Query= TCDB::Q8YPM8 (308 letters) >NCBI__GCF_003217355.1:WP_110804905.1 Length = 262 Score = 108 bits (270), Expect = 1e-28 Identities = 66/207 (31%), Positives = 111/207 (53%), Gaps = 14/207 (6%) Query: 90 AFVGIILTTIVGILAGIARLSDNWLVRNISLVYVEIFRNTPLLLQLLFWYFAVFLGLPRA 149 AF G + ++G++ +A LS + + R ++ Y E+ R P+++ LL+ FA+ + Sbjct: 54 AFAGAL---VLGLVLAVASLSRHLIWRQLARFYTEVIRGVPIIVMLLYVAFALVPAVVAG 110 Query: 150 DNKISLGGFIGLSQNGLELPWFTFSPEFSALLLGLIFYTGAFIAEIVRGGIQSVSKGQWE 209 N + GL P + +L LI AF+AE+ R G+ SV +GQ E Sbjct: 111 WNAL-----------GLPEASVRDFPLLARAVLALILAYAAFLAEVFRAGLLSVERGQIE 159 Query: 210 AGRSLGLNPSLIMRLVIFPQALRVIIPPLTSQYLNLTKNSSLAIAIGYPDIYFVASTTFN 269 A ++LGLN L RL+IFPQA R ++PPL + ++ + K+SSL +G DI + T Sbjct: 160 AAKALGLNGWLRFRLIIFPQAFRTVLPPLGNDFVAMVKDSSLVSVLGVADITQLGKVTAA 219 Query: 270 QTGKAVEVMLLLMLTYLSLSLTISLIM 296 + E ++ L YL++++T+SL + Sbjct: 220 GNFRYFETYNVVALIYLAMTVTLSLAL 246 Lambda K H 0.328 0.143 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 262 Length adjustment: 26 Effective length of query: 282 Effective length of database: 236 Effective search space: 66552 Effective search space used: 66552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory