Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate WP_110804034.1 C8J30_RS01980 carbohydrate ABC transporter permease
Query= uniprot:A3DE71 (289 letters) >NCBI__GCF_003217355.1:WP_110804034.1 Length = 382 Score = 128 bits (321), Expect = 2e-34 Identities = 74/237 (31%), Positives = 127/237 (53%), Gaps = 9/237 (3%) Query: 56 IAPTRFS--NYVEVFQKLPFGIYFRNSLIVCSIVMVVALVIATLAGYSLAKYKFPGSGFF 113 +AP R + NY V G F N++ V V+ ++IA A Y+LA +FPG Sbjct: 151 VAPPRLTTGNYARVITAEGIGRAFLNTMTVTIPATVIPILIAAFAAYALAWMRFPGRALL 210 Query: 114 GILILATQLLPGMMFLLPLYLDFVKIKQATGIQLINSIPGLVIVYSAFFVPFSIWIIRGF 173 I+ ++P + L+PL +K I L S G+ + ++ F +P +I+++R + Sbjct: 211 VATIVGLLVVPLQLALIPL------LKLHNQIGLNQSYLGIWLAHTGFGLPLAIYLLRNY 264 Query: 174 FASIPGELEEAARIDGCNKFTAFLRVMLPLAVPGIVATAIYIFLTAWDELIFAWVLLKDT 233 +P E+ E+AR+DG +F F R++LPL+ P + + AI+ FL W++L+ A V L + Sbjct: 265 MVGLPREIIESARVDGATEFQIFRRIVLPLSFPALASFAIFQFLWVWNDLLVATVFLGNA 324 Query: 234 KVTTIPAG-IRGFIAYTTARYDLLMAAGTIVTIPVLIMFFTMQKKFISGMTAGAVKG 289 T + G +R + +++L A+ + LI+FF +QK + G+ AG+VKG Sbjct: 325 TDTQVMTGALRALLGSRGGDWEILAASAFVSIAVPLIVFFALQKYLVRGLLAGSVKG 381 Lambda K H 0.332 0.145 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 382 Length adjustment: 28 Effective length of query: 261 Effective length of database: 354 Effective search space: 92394 Effective search space used: 92394 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory