Align MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate WP_110805339.1 C8J30_RS08100 ABC transporter ATP-binding protein
Query= TCDB::P96483 (377 letters) >NCBI__GCF_003217355.1:WP_110805339.1 Length = 348 Score = 249 bits (636), Expect = 8e-71 Identities = 130/267 (48%), Positives = 182/267 (68%), Gaps = 11/267 (4%) Query: 21 VDQLDIAIEDGEFLVLVGPSGCGKSTSLRMLAGLEDVNGGAIRIGDRDVTHLPPKDRDIA 80 V ++ +E GEF+ L+GPSGCGK+T LRM+AG E GAI I ++VT L P R+I Sbjct: 19 VKDFNLTVEKGEFISLLGPSGCGKTTVLRMVAGFELPTSGAITIAGKEVTDLKPNQRNIG 78 Query: 81 MVFQNYALYPHMTVADNMGFALKIAGVPKAEIRQKVEEAAKILDLTQYLDRKPKALSGGQ 140 MVFQ YAL+P++TVA N+GF LK+ G PKA I ++VEE ++ L +R P LSGGQ Sbjct: 79 MVFQAYALFPNLTVAQNVGFGLKVKGTPKAAIDKRVEEMLSLIGLPDLGNRYPFQLSGGQ 138 Query: 141 RQRVAMGRAIVREPQVFLMDEPLSNLDAKLRVSTRTQIASLQRRLGITTVYVTHDQVEAM 200 +QRVA+ RA+ +P V L+DEPLS LDAK+RVS R +I ++QR LGITT++VTHDQ EA+ Sbjct: 139 QQRVALARALAPKPSVLLLDEPLSALDAKVRVSLRNEIRAIQRELGITTIFVTHDQEEAL 198 Query: 201 TMGDRVAVLKDGLLQQVDSPRNMYDKPANLFVAGFIGSPAMNLVEVPITD---GGVKFGN 257 +M DRV V+ +G+ QV +P ++Y++P+ FVA F+G+ +N + V + D G VK G Sbjct: 199 SMSDRVVVMHEGIADQVGTPFDIYNRPSTRFVASFVGT--LNTLNVQVLDAANGRVKLGA 256 Query: 258 SVVPVNREALSAADKGDRTVTVGVRPE 284 + + + R S VT+G+RPE Sbjct: 257 TEIALGRSLPSG------PVTLGLRPE 277 Lambda K H 0.317 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 348 Length adjustment: 29 Effective length of query: 348 Effective length of database: 319 Effective search space: 111012 Effective search space used: 111012 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory