Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_110806731.1 C8J30_RS15435 ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_003217355.1:WP_110806731.1 Length = 592 Score = 112 bits (280), Expect = 2e-29 Identities = 74/228 (32%), Positives = 122/228 (53%), Gaps = 4/228 (1%) Query: 3 LRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLG 62 +R E + +SYG VL +S S GK TAL+GP+G GKS++ N +RL+ QSG + LG Sbjct: 355 IRFEQVGLSYGQKPVLRGLSFSAEAGKTTALVGPSGAGKSSIFNLLTRLVEAQSGAITLG 414 Query: 63 DNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWL-SLWGRLSAEDNARVNV 121 PI L L +++ Q + T++E + GR + R + R V Sbjct: 415 GVPITALDPAVLRSLFAMVTQDAALFDE-TIRENILLGRQDVTPEVLARAIEVAHVREFV 473 Query: 122 AMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLM 181 ++ A R + LSGGQRQR +A + ++ P++LLDE T+ LD + + + Sbjct: 474 EAMPLGLDTPAGPRGSALSGGQRQRVAIARAVLRDAPILLLDEATSALDTASEAKVAEAL 533 Query: 182 GELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPG 229 EL +QG+T + + H L+ R D++VV+ G V+ +G+ ++++ G Sbjct: 534 TEL-SQGRTTLVIAHRLSTV-RNADKIVVIVEGQVVEEGSHDDLLARG 579 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 592 Length adjustment: 30 Effective length of query: 225 Effective length of database: 562 Effective search space: 126450 Effective search space used: 126450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory