Align glutarate-semialdehyde dehydrogenase (EC 1.2.1.20) (characterized)
to candidate WP_110806822.1 C8J30_RS15880 aldehyde dehydrogenase family protein
Query= BRENDA::Q88RC0 (480 letters) >NCBI__GCF_003217355.1:WP_110806822.1 Length = 478 Score = 295 bits (755), Expect = 2e-84 Identities = 174/477 (36%), Positives = 265/477 (55%), Gaps = 21/477 (4%) Query: 10 RQQAYINGEWLDADNGQTIKVTNPATGEVIGTVPKMGTAETRRAIEAADKALPAWRALTA 69 ++Q YI+G+W+ + + V +P+T E + A+T A+ AA +A P W A Sbjct: 4 KRQFYIDGKWVGPEAPRDHFVIDPSTEEPCAIISLGDQADTDAAVTAALRAGPGWAATPP 63 Query: 70 KERSAKLRRWFELMIENQDDLARLMTTEQGKPLAEAKGE-----IAYAASFIEWFAEEAK 124 ER A + R + +++A M+ E G P+ A+ I + ++FI A+E + Sbjct: 64 AERLAAVERILAIYQARGEEMAAAMSLEMGAPIDFARESQVGAGIWHISNFIR-AAQEFE 122 Query: 125 RIY--GDTIPGHQPDKRLIVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPA 182 ++ G+ PG ++ +P+GV ITPWN+P +T K PAL AGCTMVLKP+ Sbjct: 123 WVHPLGEGTPG------AMIAYEPVGVVGLITPWNWPMNQVTLKVIPALIAGCTMVLKPS 176 Query: 183 SQTPYSALALVELAHRAGIPAGVLSVVTGSAGEVGGELTGNSLVRKLSFTGSTEIGRQLM 242 + P S+L E H AG+PAGV ++V G VG +L+ + V +SFTGST G+ + Sbjct: 177 EEAPLSSLLFAEFVHEAGVPAGVFNLVNGDGLGVGTQLSTHPDVEMISFTGSTRAGKAIS 236 Query: 243 EECAKDIKKVSLELGGNAPFIVFDDADLDKAVEGAIISKYRNNGQTCVCANRIYVQDGVY 302 + A +K+V LELGG +VF DAD DKAV + N+GQ+C R+ V+ +Y Sbjct: 237 QAAAATLKRVCLELGGKGANLVFADAD-DKAVARGVRHCMNNSGQSCNAPTRMLVERPLY 295 Query: 303 DAFAEKLAAAVAKLKIGNGLEEGTTTGPLIDGKAVAKVQEHIEDAVSKGAKVLSGG---- 358 D E A A +KIG+ E G GP+++ K+Q IE + +GA++++GG Sbjct: 296 DRAVEIAAEVAASIKIGSAHEPGRHIGPVVNAAQFEKIQGLIETGIKEGARLVAGGLGRP 355 Query: 359 -KLIEGNFFEPTILVDVPKTAAVAKEETFGPLAPLFRFKDEAEVIAMSNDTEFGLASYFY 417 L +G F PT+ DV V +EE FGP+ + F EAE + ++N T +GL +Y Sbjct: 356 EGLNKGFFIRPTVFADVTPEMTVMREEIFGPVLSIMPFDTEAEAVEIANATPYGLTNYVQ 415 Query: 418 ARDMSRVFRVAEALEYGMVGINTGLISNEVAPFGGIKASGLGREGSKYGIEDYLEIK 474 ++D +R R+A L GMV +N G APFGG++ASG REG ++GIE++ E+K Sbjct: 416 SQDGARRNRLARLLRSGMVEMN-GQSRGAGAPFGGVRASGRAREGGRWGIEEFCEVK 471 Lambda K H 0.317 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 535 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 480 Length of database: 478 Length adjustment: 34 Effective length of query: 446 Effective length of database: 444 Effective search space: 198024 Effective search space used: 198024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory