Align 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 (characterized)
to candidate WP_110803705.1 C8J30_RS00085 aspartate aminotransferase family protein
Query= SwissProt::P50457 (421 letters) >NCBI__GCF_003217355.1:WP_110803705.1 Length = 466 Score = 186 bits (472), Expect = 1e-51 Identities = 139/412 (33%), Positives = 213/412 (51%), Gaps = 30/412 (7%) Query: 30 ENATLKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHT-AYQIVPYESYVTL 88 E A L D EG ID +G+ ++ GH P+L+AA QLQQ Y + V L Sbjct: 46 EGAFLIDAEGRRLIDGLSGMWNVHLGHARPELIAAATTQLQQLAFANTYAGASHGPGVAL 105 Query: 89 AEKINALAPVSGQAKTAFFTT-GAEAVENAVKIAR---AHTGRPG---VIAFSGGFHGRT 141 AEK++ +AP +A FFTT G+EA E +V+ AR G+P +I+ +HG T Sbjct: 106 AEKLSEIAPEGIEA--FFFTTSGSEATETSVRTARWFWQSVGQPRKTKIISRDYSYHGST 163 Query: 142 YMTMALTGKVAPYKIGFGPFPGSVYHVP--YPSDLHGISTQDSLDAIERLFKSDIEAKQV 199 + ++TG V + GFGP + H+P YP G Q++ D +E+ + + V Sbjct: 164 GVAASVTG-VTEFSQGFGPPAPDILHIPSPYPYRFEGTG-QEAADLLEQAILRE-GPETV 220 Query: 200 AAIIFEPVQGEGGFNVAPKE-LVAAIRRLCDEHGIVMIADEVQSGFARTGKLFAMDHYAD 258 AA I EPVQG GG + P++ IR +CD + ++ IADEV +GF RTG FA+ H+ Sbjct: 221 AAFIAEPVQGGGGGVIVPQDDYFPRIREICDRYDVLFIADEVITGFGRTGHWFAVAHWGV 280 Query: 259 KPDLMTMAKSLAGG-MPLSGVVGNANI---MDAPAPGGL---GGTYAGNPLAVAAAHAVL 311 +PD++ AK + G +PL G+ + I +DA P G T + +P+A A A + Sbjct: 281 RPDIVQFAKGITSGYIPLGGIGVSGRIKAALDAAPPAKRWWHGFTASAHPVACAVALETI 340 Query: 312 NIIDKESLCERANQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAVEFNDPQTGE----PS 367 I++ E L ERA + G+ L L P + +RGLG + +E +T + P Sbjct: 341 RILEAEGLAERAARKGKHLLGRLHAGLADHPNVGDIRGLGLLFGIELVADRTTKRRFGPE 400 Query: 368 AAIAQKIQQRALAQGLLLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDAL 419 +A ++++ A+G L+ +VI PLT PDA+ +A I+ A+ Sbjct: 401 TDLAPRLRRELFARG---LSTRVLTDVICLAPPLTTPDAELEAIADIVTGAI 449 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 526 Number of extensions: 37 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 466 Length adjustment: 32 Effective length of query: 389 Effective length of database: 434 Effective search space: 168826 Effective search space used: 168826 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory