Align Fructose-bisphosphate aldolase class 1; EC 4.1.2.13; Fructose-bisphosphate aldolase class I; FBP aldolase (uncharacterized)
to candidate WP_110804301.1 C8J30_RS02965 fructose bisphosphate aldolase
Query= curated2:Q8RGH3 (295 letters) >NCBI__GCF_003217355.1:WP_110804301.1 Length = 294 Score = 340 bits (871), Expect = 3e-98 Identities = 177/290 (61%), Positives = 219/290 (75%), Gaps = 3/290 (1%) Query: 5 LEKMRNGKGFIAALDQSGGSTPKALKLYGVNENEYSNDKEMFDLIHKMRTRIIKSPAFNE 64 +E MR G+GFIAALDQSGGSTPKAL+LYG+ E+ YSN+ EM+DLIH MR RIIKS AF Sbjct: 6 MEHMRKGEGFIAALDQSGGSTPKALRLYGITEDAYSNETEMYDLIHAMRARIIKSSAFTG 65 Query: 65 SKILGAILFEQTMDSKIDGKYTADFLWEEKKVLPFLKIDKGLNDLDADGVQTMKPNPTLA 124 K++GAILFEQTMD IDG TA +LWE++ V+PFLKIDKGL + + +G Q +K PTL Sbjct: 66 DKVVGAILFEQTMDRDIDGIPTATYLWEKRGVVPFLKIDKGLEE-EKNGCQMLKAMPTLD 124 Query: 125 DLLKRANERHIFGTKMRSVIKKASPAGIARVVEQQFEVAAQVVAAGLIPIIEPEVDINNV 184 LL+RA E IFGTK RSVI A P GIA VV QQFEV QV+ AG++PI+EPEV I+ Sbjct: 125 ALLERAAEAGIFGTKERSVISAADPMGIASVVAQQFEVGEQVLGAGMVPILEPEVTISIA 184 Query: 185 DKVQCEEILRDEIRKHLNALPETSNVMLKLTLPTVENLYEEFTKHPRVVRVVALSGGYSR 244 DK+ E +LRD + L + +S VMLKL+LPT++N Y +HP V++VVALSGGY+R Sbjct: 185 DKIDAEAMLRDALLAGLETV--SSPVMLKLSLPTIDNFYLPLVEHPNVIKVVALSGGYAR 242 Query: 245 EKANDILSKNKGVIASFSRALTEGLSAQQTDEEFNKTLAASIDGIYEASV 294 AN IL++NKG+IASFSRALTEGL+AQ TD EF+ L +ID IY AS+ Sbjct: 243 NDANAILARNKGMIASFSRALTEGLTAQMTDAEFDAALGEAIDSIYRASI 292 Lambda K H 0.314 0.132 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 294 Length adjustment: 26 Effective length of query: 269 Effective length of database: 268 Effective search space: 72092 Effective search space used: 72092 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory