Align Fructose import binding protein FrcB (characterized)
to candidate WP_110804308.1 C8J30_RS03215 sugar ABC transporter substrate-binding protein
Query= SwissProt::Q9F9B2 (341 letters) >NCBI__GCF_003217355.1:WP_110804308.1 Length = 338 Score = 481 bits (1239), Expect = e-141 Identities = 243/334 (72%), Positives = 273/334 (81%) Query: 8 AAFGALAMGVAFASPSQAAEVSACLITKTDTNPFFVKMKEGAAAKAKELGVTLKSYAGKI 67 A GA A+ + + AE ACLITKTDTNPFFVKMKEGA A+A++LG+TLKSYAGK+ Sbjct: 5 ALLGASAVAMTALAGGAFAETGACLITKTDTNPFFVKMKEGAQAEAEKLGITLKSYAGKV 64 Query: 68 DGDSESQVAAIETCIADGAKGILIAASDTQGIVPQVQKARDAGLLVIALDTPLEPLDAAD 127 DGD+E+QVAAIETCIADGAKGILI SDT+ IVP VQKAR+AG+LVIALDTPL+P+DAAD Sbjct: 65 DGDNEAQVAAIETCIADGAKGILITPSDTKAIVPTVQKAREAGILVIALDTPLDPMDAAD 124 Query: 128 ATFATDNLLAGKLIGQWAAATLGDAAKEAKVAFLDLTPSQPSVDVLRDQGFMIGFGIDPK 187 TFATDN AG LIGQWA A LGDAA AK+A LDL SQP+VDVLRDQGF+ GFGID Sbjct: 125 MTFATDNFSAGLLIGQWAKANLGDAAANAKIAMLDLAVSQPTVDVLRDQGFLQGFGIDLG 184 Query: 188 DPNKIGDEDDPRIVGHDITNGNEEGGRTAMENLLQKDPTINVVHTINEPAAAGAYEALKS 247 D NK GDE D RIVGHD+T GNEEGGR AMENLL KDP INVV+TINEPAAAGAYEALK+ Sbjct: 185 DANKWGDETDARIVGHDVTAGNEEGGRKAMENLLAKDPDINVVYTINEPAAAGAYEALKA 244 Query: 248 VGREKDVLIVSVDGGCPGVKNVAEGVIGATSQQYPLMMAALGIEAIKKFADTGEKPTPTE 307 VG+++ LIVSVDGGCPGVKNV GVIGATSQQYP++MA+ GIEAI FA G KP TE Sbjct: 245 VGKDQGTLIVSVDGGCPGVKNVEGGVIGATSQQYPMLMASKGIEAIAAFAKDGTKPAATE 304 Query: 308 GKDFVDTGVSLVADKPVSGVESIDTKTGMEKCWG 341 GK F DTGV L+ DKPV GV SID+K G+ CWG Sbjct: 305 GKTFFDTGVQLITDKPVEGVPSIDSKAGLGICWG 338 Lambda K H 0.313 0.132 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 483 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 338 Length adjustment: 28 Effective length of query: 313 Effective length of database: 310 Effective search space: 97030 Effective search space used: 97030 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory