Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate WP_110804036.1 C8J30_RS01990 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SM_b21106 (365 letters) >NCBI__GCF_003217355.1:WP_110804036.1 Length = 361 Score = 285 bits (728), Expect = 2e-81 Identities = 170/333 (51%), Positives = 211/333 (63%), Gaps = 33/333 (9%) Query: 1 MAPVTLKKLVKRYGALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAI 60 MA + L ++ K YG ++V+ I+L++K E I VGPSGCGKST LRMIAGLE +S G + Sbjct: 1 MADLKLTRVGKSYGEVDVLRDINLDIKAGELIVFVGPSGCGKSTLLRMIAGLERISAGEL 60 Query: 61 EIGGRKVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAI 120 I G +VND+PP R I+MVFQSYALYPHMTV +NM F+LKIA + ++I V AA I Sbjct: 61 RIDGVRVNDMPPAQRGIAMVFQSYALYPHMTVRQNMEFALKIAKKTRQDIDKAVENAARI 120 Query: 121 LDLAHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLH 180 L L L+R P LSGGQRQRVA+GRAIVR P V+LFDEPLSNLDA LR R EI +L Sbjct: 121 LQLTPYLDRLPKALSGGQRQRVAIGRAIVRDPKVYLFDEPLSNLDAALRVATRIEIAQLK 180 Query: 181 ARM-QATMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIGSPPM 239 M + TMIYVTHDQVEAMTL+ RIV++ + I QVGTP +++ +P T+FVA FIGSP M Sbjct: 181 EAMPERTMIYVTHDQVEAMTLASRIVVLANKGIAQVGTPLELYEKPETEFVAQFIGSPQM 240 Query: 240 NMEEAV-----------LTDGKLAFASGATLPLPPRFRSLVREGQKVTFGLRPDD--VYP 286 N+ V L DG A +T+P P G +V G+RP+D V Sbjct: 241 NLLPGVIRETGAVTVVALDDGGTA---RSTVPTSP-----ADLGLRVNIGVRPEDLTVIT 292 Query: 287 SGHGLHAGDADAVHEIELPVTITEPLGNETLVF 319 G GL G V I E LG TL++ Sbjct: 293 EG-GLFTG----------VVEIVEALGEVTLLY 314 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 361 Length adjustment: 29 Effective length of query: 336 Effective length of database: 332 Effective search space: 111552 Effective search space used: 111552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory