Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate WP_110804244.1 C8J30_RS03245 ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b21106 (365 letters) >NCBI__GCF_003217355.1:WP_110804244.1 Length = 332 Score = 303 bits (777), Expect = 3e-87 Identities = 171/361 (47%), Positives = 227/361 (62%), Gaps = 33/361 (9%) Query: 1 MAPVTLKKLVKRYGALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAI 60 M + LK + KR+G +EV+ IDL + D EF+ VGPSGCGKST LR+IAGLE+VSGG I Sbjct: 1 MGEIVLKGVTKRFGDVEVIPPIDLAIHDGEFVVFVGPSGCGKSTLLRLIAGLEDVSGGKI 60 Query: 61 EIGGRKVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAI 120 EI G+ + P R ++MVFQSYALYPHM+V +N+ F LK+A P EI+ +V AA + Sbjct: 61 EIDGKDATETAPSDRGLAMVFQSYALYPHMSVKKNIAFPLKMAKLPPAEIEAKVQAAAKV 120 Query: 121 LDLAHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLH 180 L+L+ L+R+P QLSGGQRQRVA+GRAIVR P+ FLFDEPLSNLDA LR +R EI +LH Sbjct: 121 LNLSAYLDRKPGQLSGGQRQRVAIGRAIVRSPEAFLFDEPLSNLDAALRVNMRLEISELH 180 Query: 181 ARMQATMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIGSPPMN 240 ++ TMIYVTHDQVEAMT++D+IV+++ G IEQVG+P +++R P +FVAGFIGSP MN Sbjct: 181 HTLKTTMIYVTHDQVEAMTMADKIVVLQAGRIEQVGSPLELYRTPRNRFVAGFIGSPKMN 240 Query: 241 MEEAVLTDGKLAFASGATLPLPPRFRSLVREGQKVTFGLRPDDV-YPSGHGLHAGDADAV 299 E G A GA G+RP+ + + G+ G Sbjct: 241 FIE-----GAEAAKHGAH-----------------AIGIRPEHIRISTTEGMWKG----- 273 Query: 300 HEIELPVTITEPLGNETLVFTQFNGRDWVSRMLNPRPLRPGEAVPMSFDLARAHLFDGET 359 V ++E LG++T + R L G++V +S D+A+ H FD E Sbjct: 274 -----TVGVSEHLGSDTFLHVTTEHGLLNVRAGGEVDLHHGDSVFLSPDMAQLHRFDKEG 328 Query: 360 G 360 G Sbjct: 329 G 329 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 332 Length adjustment: 29 Effective length of query: 336 Effective length of database: 303 Effective search space: 101808 Effective search space used: 101808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory