Align Galactose/methyl galactoside import ATP-binding protein MglA; EC 7.5.2.11 (characterized)
to candidate WP_110805879.1 C8J30_RS10885 sugar ABC transporter ATP-binding protein
Query= SwissProt::P23924 (506 letters) >NCBI__GCF_003217355.1:WP_110805879.1 Length = 511 Score = 323 bits (829), Expect = 7e-93 Identities = 175/477 (36%), Positives = 289/477 (60%), Gaps = 5/477 (1%) Query: 14 LEMRGINKSFPGVKALDNVNLNVRPHSIHALMGENGAGKSTLLKCLFGIYQKDSGSIVFQ 73 L +RG K +PG +AL V+ ++R +++ L+GENGAGKSTL+K + G+ G+I Sbjct: 9 LSIRGGVKVYPGTRALKGVDFDLRMGAVNVLVGENGAGKSTLMKLIAGVEDMTEGTITMD 68 Query: 74 GKEVDFHSAKEALENGISMVHQELNLVLQRSVMDNMWLGRYPTKG-MFVDQDKMYQDTKA 132 G+E+ F + +A+ GI +V QELNL SV +N+++G T+G + +D + + T+ Sbjct: 69 GREMRFRTKADAVAAGIGIVFQELNLFPNLSVAENIFIGHETTRGGIDIDIEAHREATRQ 128 Query: 133 IFDELDIDIDPRARVGTLSVSQMQMIEIAKAFSYNAKIVIMDEPTSSLTEKEVNHLFTII 192 + + L+ +I P +G L + Q Q++EIAKA + NA+I+I+DEPTS+L+ EV LF +I Sbjct: 129 LMERLEQNIHPDTPLGNLRIGQQQIVEIAKALAQNARILILDEPTSALSAAEVEVLFRVI 188 Query: 193 RKLKERGCGIVYISHKMEEIFQLCDEITILRDGQWIATQPLEGLDMDKIIAMMVGRSLNQ 252 +L +G GIVYISH++EE+ ++ D IT+LRDG + +EG+D+ I+ M+G S + Sbjct: 189 DELTAQGVGIVYISHRLEELIRVGDYITVLRDGVITGARSMEGVDIPWIVKAMIGSSSKE 248 Query: 253 RFPDKENKPGDVILEVRHLTSLRQP---SIRDVSFDLHKGEILGIAGLVGAKRTDIVETL 309 + G I +T R ++ VS + GEI+G+ GL+GA R++ +E + Sbjct: 249 YGRSEVANFGPEIFRAEDITLPRAGGGFTVDHVSLSIRSGEIVGLYGLMGAGRSEFLECV 308 Query: 310 FGIREKSSGTITLHGKKINNHTANEAINHGFALVTEERRSTGIYAYLDIGFNSLISNIRN 369 S G + GK + I G AL+ E+R+ G+ + I N +S++ + Sbjct: 309 MAQHPHSGGKFWVEGKPLTERDVPGRIARGIALIPEDRKRDGLIQIMSIRENLTLSSLPS 368 Query: 370 YKNKVGLLDNSRMKSDTQWVIDSMRVKTPGHRTQIGSLSGGNQQKVIIGRWLLTQPEILM 429 + K+ LD + I + +K + SLSGGNQQKV+IG+ L+T P++L+ Sbjct: 369 F-TKLFHLDLKKEAKTAVEFIKRLTIKVASPENPVSSLSGGNQQKVVIGKALMTGPKVLL 427 Query: 430 LDEPTRGIDVGAKFEIYQLIAELAKKGKGIIIISSEMPELLGITDRILVMSNGLVSG 486 +DEP+RGID+GAK E+++ + LA +G GI+ ++S++ E+L ++DRI+VM+ G V+G Sbjct: 428 MDEPSRGIDIGAKAEVFRTMRRLAAEGLGILFVTSDLDEVLALSDRIIVMAQGRVTG 484 Lambda K H 0.319 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 594 Number of extensions: 30 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 506 Length of database: 511 Length adjustment: 34 Effective length of query: 472 Effective length of database: 477 Effective search space: 225144 Effective search space used: 225144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory