Align galactofuranose ABC transporter putative ATP binding subunit (EC 7.5.2.9) (characterized)
to candidate WP_110806491.1 C8J30_RS14105 sugar ABC transporter ATP-binding protein
Query= ecocyc::YTFR-MONOMER (500 letters) >NCBI__GCF_003217355.1:WP_110806491.1 Length = 513 Score = 358 bits (918), Expect = e-103 Identities = 192/494 (38%), Positives = 303/494 (61%), Gaps = 6/494 (1%) Query: 9 ILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTGVYHADRGTIWL 68 IL +G+ K FPGV ALDNV +R G + AL+GENGAGKSTL+K + GVY+ DRG + Sbjct: 22 ILEVDGVRKEFPGVVALDNVQLKIRPGSVHALMGENGAGKSTLMKIIAGVYNPDRGEVRF 81 Query: 69 EGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPK-RFGLLRRKEMEKRAT 127 G+ + + A GI ++QE+NL+ M+VA+N++I REPK FGL+ M Sbjct: 82 AGEKLVIRTPIDALNCGIAMIHQELNLMNTMTVAENVWIRREPKGAFGLIDHARMGTMTA 141 Query: 128 ELMASYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQEVELLFDL 187 EL AS LD + +VA +Q++ I +A+ ++ VLI+DEPT+++ EVE LF + Sbjct: 142 ELFASLNIHLDPLAIVGDLTVAQKQMIEIAKAVSYNSDVLIMDEPTSAITETEVEHLFAI 201 Query: 188 MRQLRDRGVSLIFVTHFLDQVYQVSDRITVLRNGSFVGCRETCELPQIELVKMMLGRELD 247 +R LR RGV ++++TH ++++++++D +TV R+G ++ E+ + ++++MM+GRE+ Sbjct: 202 IRDLRARGVGIVYITHKMNEIFEIADELTVFRDGKYISTVPASEVTRDDIIRMMVGREI- 260 Query: 248 THALQRAGRTLLSDKPVAAFKNYGKKGTIAPFDLEVRPGEIVGLAGLLGSGRTETAEVIF 307 T + + + +N G ++R GEI+G+AGL+GSGR+ AE +F Sbjct: 261 TEMFPKVDCPI--GDVILDVQNLSLPGVFDNISFKLRKGEILGVAGLVGSGRSNVAEALF 318 Query: 308 GIKPADSGTALIKGKPQNLRSPHQASVLGIGFCPEDRKTDGIIAAASVRENIILAL--QA 365 G+ PA++G I G+ + SP A G+ F EDRK G EN+ +AL + Sbjct: 319 GVHPAETGDIWIDGEHVVMTSPQVAMDHGLAFLTEDRKETGCFLVLDCLENMQMALITRD 378 Query: 366 QRGWLRPISRKEQQEIAERFIRQLGIRTPSTEQPIEFLSGGNQQKVLLSRWLLTRPQFLI 425 + + + E + + + +L ++TP+ + +E LSGGNQQK+L++RWLLT P+ LI Sbjct: 379 KVNGAGFVQQAEVTRLVQEYSAKLRVKTPNLAERVENLSGGNQQKLLIARWLLTNPRILI 438 Query: 426 LDEPTRGIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIIMRDRKQVAEIP 485 LDEPTRGIDVGA +EI RLI L G+A+L+ISSEL E++G +DR+++M + + + Sbjct: 439 LDEPTRGIDVGAKSEIHRLITALAGQGVAVLMISSELPEVLGMSDRIMVMHEGRVSGFLD 498 Query: 486 LAELSVPAIMNAIA 499 AE + +M A Sbjct: 499 RAEATQVRVMELAA 512 Lambda K H 0.321 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 566 Number of extensions: 27 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 500 Length of database: 513 Length adjustment: 34 Effective length of query: 466 Effective length of database: 479 Effective search space: 223214 Effective search space used: 223214 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory