Align Galactofuranose transporter permease protein YtfT (characterized)
to candidate WP_110805878.1 C8J30_RS10880 ABC transporter permease
Query= SwissProt::P39328 (341 letters) >NCBI__GCF_003217355.1:WP_110805878.1 Length = 352 Score = 155 bits (391), Expect = 2e-42 Identities = 101/315 (32%), Positives = 160/315 (50%), Gaps = 26/315 (8%) Query: 26 VALLLVLLVDSLVAPHFWQVVLQDGRLFGSPIDILNRAAPVALLAIGMTLVIATGGIDLS 85 +AL+LV + +AP+F V + + + AA A LAIGMT VI TGGIDLS Sbjct: 26 LALILVFGFFAFMAPNFLSVA--------NSVIVAKHAALTAFLAIGMTFVIITGGIDLS 77 Query: 86 VGAVMAIA----------GATTAAMTVAGFSLPIVLLSALGTGILAGLWNGILVAILKIQ 135 VG+ + + G AM F+ + L + G+ G NGIL+ L + Sbjct: 78 VGSTVGLCAMVSGWLILYGIDLGAMGTMQFNTLEIALLVMCVGVFVGFVNGILITKLNVA 137 Query: 136 PFVATLILMVAGRGVAQLITAGQI-------VTFNSPDLSWFGSGSLLFLPTPVIIAVLT 188 PF+ATL + RG A L + G+ + S G+G+ L LP + + + Sbjct: 138 PFIATLGTLYIARGAALLSSGGRTFPNLSGNADYGSASFPGIGAGTFLGLPVQIWMLIAV 197 Query: 189 LILFWLLTRKTALGMFIEAVGINIRAAKNAGVNTRIIVMLTYVLSGLCAAIAGIIVAADI 248 ++ + ++T LG I AVG N R A +GV + + Y+ SG CAAI G+I+A+ + Sbjct: 198 GLVAAYIAKRTPLGRHIYAVGGNERGAALSGVKVNRVKLFVYMFSGFCAAIVGLIIASQL 257 Query: 249 RGADANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVVGALIIQGMNTGILLSGFPPEM 308 + A G EL+AI A V+GG SL GGR + ++VGA +I ++ G+++ Sbjct: 258 QAAHP-ATGETFELNAIAAAVLGGTSLSGGRGKIGGTIVGAFVISILSDGLVMMSVSSFW 316 Query: 309 NQVVKAVVVLCVLIV 323 V+K +V++ +++ Sbjct: 317 QTVIKGLVIVAAVVI 331 Lambda K H 0.327 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 352 Length adjustment: 29 Effective length of query: 312 Effective length of database: 323 Effective search space: 100776 Effective search space used: 100776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory