Align ABC transporter for D-glucosamine, permease component 2 (characterized)
to candidate WP_110806870.1 C8J30_RS16145 ABC transporter permease subunit
Query= reanno::pseudo3_N2E3:AO353_21720 (220 letters) >NCBI__GCF_003217355.1:WP_110806870.1 Length = 232 Score = 92.0 bits (227), Expect = 8e-24 Identities = 64/210 (30%), Positives = 103/210 (49%), Gaps = 11/210 (5%) Query: 18 LWSGFLTSVQCSVLAIMLGTLIGIVAGLVLTYGTLWMRAPFRFYVDLIRGTPVFVLVLAC 77 L G T++ + L L + L+ +G + R Y+ +RGTP+ + Sbjct: 14 LLDGAETTLILTGLGAALAAVFSPGLALIRLFGPTPAKMLLRAYISFVRGTPLLAQLFLV 73 Query: 78 FYMA-------PALG-WQI--DAFQAGVLGLTLFCGSHVAEIVRGALQALPRGQMEASKA 127 FY + LG W D F VL + ++ EI+RG ++A+P G++EA++A Sbjct: 74 FYGSGQFRAELTGLGLWSFFRDPFNCAVLVFVINSCAYQTEILRGGIEAVPPGEIEAARA 133 Query: 128 IGLTFYQALAYVLLPQALRQILPTWVNSSTEIVKASTLLSVIGVAELLLSTQQIIARTFM 187 IG+T + LA V+ P A R P N ++KAS L S++ V +L+ T+QI +R+F Sbjct: 134 IGMTRARVLARVIFPHAYRIAWPALGNEVILLMKASALASIVTVFDLMGRTRQIFSRSF- 192 Query: 188 TLEFYLFAGFLFFIINYAIELLGRHIEKRV 217 Y A L+ +I L R IE+R+ Sbjct: 193 EFSVYFEAAALYLLITVVFVFLWRQIERRL 222 Lambda K H 0.330 0.142 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 123 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 232 Length adjustment: 22 Effective length of query: 198 Effective length of database: 210 Effective search space: 41580 Effective search space used: 41580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory