Align ABC transporter for D-Glucosamine, putative ATPase component (characterized)
to candidate WP_110806261.1 C8J30_RS12895 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_00465 (263 letters) >NCBI__GCF_003217355.1:WP_110806261.1 Length = 265 Score = 258 bits (660), Expect = 7e-74 Identities = 135/257 (52%), Positives = 174/257 (67%) Query: 5 STPSNTQPLLDIRGLRKQYGPLEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNMLEE 64 + PS T P+++IR L K YG LEVLKGV + +RG VV+LIGSSGSGK+TLLRC N+LE+ Sbjct: 6 TAPSPTAPVIEIRDLHKSYGSLEVLKGVSIRAERGTVVSLIGSSGSGKSTLLRCCNLLED 65 Query: 65 FQGGQIVLDGESIGYDDIDGKRVRHPEKLIARHRAMTGMAFQQFNLFPHLTALQNVTLGL 124 Q G+++ GE++ + R + R R M FQQFNL+ H+T LQNV Sbjct: 66 SQSGEVIFSGEAVKWQGTGLARRPSDRAQVTRFRTNLSMVFQQFNLWSHMTILQNVMEAP 125 Query: 125 LKVKKLPKDEAVALAEKWLERVGLLERRDHFPGQLSGGQQQRVAIARAIAMNPSLMLFDE 184 + V P E LA L +VG+ ++ D +P QLSGGQQQR AIARA+ M P +LFDE Sbjct: 126 VTVLGHPAAEVEPLARSLLAKVGIGDKADAWPAQLSGGQQQRAAIARALCMQPQALLFDE 185 Query: 185 VTSALDPELVGEVLNVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKE 244 TSALDPEL EV+ VIK LA + TM+LVTH+MR A +VSD +VF++QGRIEE+GPP+ Sbjct: 186 PTSALDPELQQEVVKVIKDLAAEHRTMILVTHDMRLAADVSDHVVFLHQGRIEEEGPPET 245 Query: 245 LFERPQSPRLAEFLKNT 261 LF P+S RL +FL T Sbjct: 246 LFGAPKSERLKQFLSAT 262 Lambda K H 0.320 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 265 Length adjustment: 25 Effective length of query: 238 Effective length of database: 240 Effective search space: 57120 Effective search space used: 57120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory