Align ABC transporter for D-Glucosamine, putative ATPase component (characterized)
to candidate WP_110806538.1 C8J30_RS14405 ABC transporter ATP-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_2050 (263 letters) >NCBI__GCF_003217355.1:WP_110806538.1 Length = 358 Score = 159 bits (401), Expect = 1e-43 Identities = 101/255 (39%), Positives = 139/255 (54%), Gaps = 21/255 (8%) Query: 13 LLDIRGLRKQYGPLE-----VLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQG 67 LLDIR R+ + E L GVDL++ G VTL+G SG GKTTLLR + EE Sbjct: 6 LLDIRAARRLFTTPEGKSFAALDGVDLAVDEGEFVTLLGPSGCGKTTLLRAIAGFEELDE 65 Query: 68 GQIMLDGESIGYDDIDGKRVRHPEKVIARHRAMTGMAFQQFNLFPHLTALQNVTLGLLKV 127 G I LDG D+ G + HR FQ + LFPH++ +NV L +V Sbjct: 66 GVIRLDGA-----DLSG---------LPPHRRPVNTVFQSYALFPHMSVARNVGYAL-EV 110 Query: 128 KKLPKDEAVALAEKWLERVGLLERRDHFPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTS 187 + P+ E A LE+VGL P QLSGGQ+QRVA+ARAI P L+L DE S Sbjct: 111 QGAPRAEREAEVAAALEKVGLAGLGTRRPAQLSGGQRQRVALARAIVAKPRLLLLDEPLS 170 Query: 188 ALDPELVGEVLNVIKGLAED-GMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELF 246 ALD L ++ +K L G+ + VTH+ A +SD+IV + G++E+ PP+E++ Sbjct: 171 ALDRNLRQQMQFELKDLQHRLGIAFVFVTHDQEEALTMSDRIVVLRAGKVEQAAPPREIY 230 Query: 247 ERPQSPRLAEFLKNT 261 P++ +AEF+ T Sbjct: 231 RHPKTRFVAEFIGET 245 Lambda K H 0.320 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 358 Length adjustment: 27 Effective length of query: 236 Effective length of database: 331 Effective search space: 78116 Effective search space used: 78116 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory