Align 2-hydroxy-3-oxopropionate reductase; Tartronate semialdehyde reductase; TSAR; EC 1.1.1.60 (characterized)
to candidate WP_110804093.1 C8J30_RS02305 NAD(P)-dependent oxidoreductase
Query= SwissProt::P0ABQ2 (294 letters) >NCBI__GCF_003217355.1:WP_110804093.1 Length = 290 Score = 164 bits (415), Expect = 2e-45 Identities = 97/280 (34%), Positives = 155/280 (55%), Gaps = 1/280 (0%) Query: 2 KVGFIGLGIMGKPMSKNLLKAGYSLVVADRNPEAIADVIAAGAET-ASTAKAIAEQCDVI 60 KV F+GLG+MG PM+ +L G+++ V +R+P +A A T A+TA A + I Sbjct: 3 KVAFLGLGVMGFPMAGHLAARGHAVTVWNRSPAKAEAWVANHAGTRAATAAEAAAGAEFI 62 Query: 61 ITMLPNSPHVKEVALGENGIIEGAKPGTVLIDMSSIAPLASREISEALKAKGIDMLDAPV 120 + + N +++V LGE G G PG + +D ++++ +RE+S KG +DAPV Sbjct: 63 MACVGNDDDLRQVCLGETGAFTGMAPGAIFVDHTTVSAQVTRELSAIAAQKGFGFVDAPV 122 Query: 121 SGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTGEIGAGNVTKLANQVIVALN 180 SGG+ A +G LSVM GG +A + ++ A A GE GAG + K+ NQ+ +A Sbjct: 123 SGGQAGAENGVLSVMCGGSEADYAAAEPVIAAYARICRRLGESGAGQLAKMCNQIAIAGL 182 Query: 181 IAAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPMVMDRNFKPGFRIDLHIKDL 240 + ++E+L A KAG++ + + I G AGS + ++ + + F GF +D KDL Sbjct: 183 VQGLAESLHFAEKAGLDAGALVEVISQGAAGSWQMTNRSKTMAENRFDFGFAVDWMRKDL 242 Query: 241 ANALDTSHGVGAQLPLTAAVMEMMQALRADGLGTADHSAL 280 L T++ GA LP+TA V + + ++ G G D S+L Sbjct: 243 GICLATANETGASLPVTALVDQFYKDVQKMGGGRWDTSSL 282 Lambda K H 0.316 0.133 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 290 Length adjustment: 26 Effective length of query: 268 Effective length of database: 264 Effective search space: 70752 Effective search space used: 70752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory