Align aspartate ammonia-lyase (EC 4.3.1.1) (characterized)
to candidate WP_110806310.1 C8J30_RS13165 class II fumarate hydratase
Query= BRENDA::Q9LCC6 (468 letters) >NCBI__GCF_003217355.1:WP_110806310.1 Length = 464 Score = 372 bits (954), Expect = e-107 Identities = 190/461 (41%), Positives = 285/461 (61%), Gaps = 1/461 (0%) Query: 3 TDVRIEKDFLGEKEIPKDAYYGVQTIRATENFPITGYRIHPELIKSLGIVKKSAALANME 62 T R E D G E+P D Y+G QT R+ NFPI + +I++LG++KK+AAL N Sbjct: 2 TATRTETDSFGPLEVPADKYWGAQTQRSILNFPIGWEKQPKPIIRALGVIKKAAALVNKA 61 Query: 63 VGLLDKEVGQYIVKAADEVIEGKWNDQFIVDPIQGGAGTSINMNANEVIANRALELMGEE 122 G ++ + + I AA EVIEGK++D F + Q G+GT NMNANEVI+NRA+E++G Sbjct: 62 QGDMEPAIAEAIAAAATEVIEGKFDDNFPLVVWQTGSGTQSNMNANEVISNRAIEMLGGV 121 Query: 123 KGNYSKISPNSHVNMSQSTNDAFPTATHIAV-LSLLNQLIETTKYMQQEFMKKADEFAGV 181 G+ + PN HVNM QS+ND FPTA H+A+ + + LI + + + K++EF + Sbjct: 122 MGSKKPVHPNDHVNMGQSSNDTFPTAMHVAIAMQARDVLIPGLEKLSKALWAKSEEFKDI 181 Query: 182 IKMGRTHLQDAVPILLGQEFEAYARVIARDIERIANTRNNLYDINMGATAVGTGLNADPE 241 IK+GRTH QDA P+ LGQEF YA + R IER+ ++Y++ G TAVGTGLN Sbjct: 182 IKIGRTHTQDATPLTLGQEFSGYATQVDRGIERVKLALPHIYELAQGGTAVGTGLNTRVG 241 Query: 242 YISIVTEHLAKFSGHPLRSAQHLVDATQNTDCYTEVSSALKVCMINMSKIANDLRLMASG 301 + + + +A+ +G P +A + +A D S ALK ++ KIAND+RL+ SG Sbjct: 242 WDTRIAAQIAEITGLPFVTAPNKFEALAAHDAMVFFSGALKTVAASLFKIANDMRLLGSG 301 Query: 302 PRAGLSEIVLPARQPGSSIMPGKVNPVMPEVMNQVAFQVFGNDLTITSASEAGQFELNVM 361 PR+GL E++LP +PGSSIMPGKVNP E + V V GND I A G FELNV Sbjct: 302 PRSGLGELILPENEPGSSIMPGKVNPTQAEALTMVCAHVMGNDAAIGFAGSQGHFELNVY 361 Query: 362 EPVLFFNLIQSISIMTNVFKSFTENCLKGIKANEERMKEYVEKSIGIITAINPHVGYETA 421 P++ +N++QS+ ++ + +FT+N + G +AN R+ + +++S+ ++TA+ P +GY+ A Sbjct: 362 NPMMSYNVLQSMQLLGDSASAFTDNMVVGTQANTARIDKLMKESLMLVTALAPTIGYDAA 421 Query: 422 AKLAREAYLTGESIRELCIKYGVLTEEQLNEILNPYEMTHP 462 K+A+ A+ G ++RE I G + E + ++ P +M P Sbjct: 422 TKVAKTAHKNGTTLREEAIALGYVDGETFDRVVRPEDMISP 462 Lambda K H 0.316 0.133 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 523 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 468 Length of database: 464 Length adjustment: 33 Effective length of query: 435 Effective length of database: 431 Effective search space: 187485 Effective search space used: 187485 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory