Align GluC aka CGL1952, component of Glutamate porter (characterized)
to candidate WP_110804905.1 C8J30_RS06530 amino acid ABC transporter permease
Query= TCDB::P48244 (228 letters) >NCBI__GCF_003217355.1:WP_110804905.1 Length = 262 Score = 113 bits (282), Expect = 4e-30 Identities = 72/226 (31%), Positives = 119/226 (52%), Gaps = 13/226 (5%) Query: 6 ADLGPSLLPAFWVTIKLTIYSAIGAMIFGTILTTMRVSPVKILRTLSTAYINTVRNTPLT 65 A + +L +T+ +T+++ GA++ G +L +S I R L+ Y +R P+ Sbjct: 34 AKIFATLSKGIGITVFVTLFAFAGALVLGLVLAVASLSRHLIWRQLARFYTEVIRGVPII 93 Query: 66 LVVLFCSFGL-------YQNLGLTLAGRESSTFLVDNNFRLAVLGFILYTSTFVAESLRS 118 +++L+ +F L + LGL A L AVL IL + F+AE R+ Sbjct: 94 VMLLYVAFALVPAVVAGWNALGLPEASVRDFPLLAR-----AVLALILAYAAFLAEVFRA 148 Query: 119 GINTVHFGQAEAARSLGLGFGATFRSIIFPQAVRAAIVPLGNTLIALTKNTTIASVIGVG 178 G+ +V GQ EAA++LGL FR IIFPQA R + PLGN +A+ K++++ SV+GV Sbjct: 149 GLLSVERGQIEAAKALGLNGWLRFRLIIFPQAFRTVLPPLGNDFVAMVKDSSLVSVLGVA 208 Query: 179 EASLLMKATIENHANMLFVVFAIFAVGFMILTLPMGLGLGKLSERL 224 + + L K T + F + + A+ ++ +T+ + L L KL L Sbjct: 209 DITQLGKVTAAGNFR-YFETYNVVALIYLAMTVTLSLALRKLEAHL 253 Lambda K H 0.327 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 262 Length adjustment: 24 Effective length of query: 204 Effective length of database: 238 Effective search space: 48552 Effective search space used: 48552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory