Align ABC transporter for Glycerol, ATPase component 1 (characterized)
to candidate WP_110804036.1 C8J30_RS01990 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::acidovorax_3H11:Ac3H11_791 (363 letters) >NCBI__GCF_003217355.1:WP_110804036.1 Length = 361 Score = 174 bits (440), Expect = 4e-48 Identities = 119/357 (33%), Positives = 184/357 (51%), Gaps = 20/357 (5%) Query: 3 LALDSISKKVGAQTWLYDMSLALQSGAVTVLLGATQAGKTSLMRIMAGLDAPTAGRVTVD 62 L L + K G L D++L +++G + V +G + GK++L+R++AGL+ +AG + +D Sbjct: 4 LKLTRVGKSYGEVDVLRDINLDIKAGELIVFVGPSGCGKSTLLRMIAGLERISAGELRID 63 Query: 63 GKDVTGMPVRDRNVAMVYQQFINYPSMKVAANIASPLKL--RGEKNIDARVREIASRLHI 120 G V MP R +AMV+Q + YP M V N+ LK+ + ++ID V A L + Sbjct: 64 GVRVNDMPPAQRGIAMVFQSYALYPHMTVRQNMEFALKIAKKTRQDIDKAVENAARILQL 123 Query: 121 DMFLDRYPAELSGGQQQRVALARALAKGAPLMLLDEPLVNLDYKLREELREELTQL-FAA 179 +LDR P LSGGQ+QRVA+ RA+ + + L DEPL NLD LR R E+ QL A Sbjct: 124 TPYLDRLPKALSGGQRQRVAIGRAIVRDPKVYLFDEPLSNLDAALRVATRIEIAQLKEAM 183 Query: 180 GQSTVVYATTEPGEALLLGGYTAVLDEGQLLQYGPTAEVFHAPNSLRVARAFSDPPMNLM 239 + T++Y T + EA+ L VL + Q G E++ P + VA+ P MNL+ Sbjct: 184 PERTMIYVTHDQVEAMTLASRIVVLANKGIAQVGTPLELYEKPETEFVAQFIGSPQMNLL 243 Query: 240 AASATAQGVRLQGGAELTLPLPQGAATAAGLTVGVRASALRVH--ARPGDVSV------- 290 GV + GA + L G + + LRV+ RP D++V Sbjct: 244 ------PGVIRETGAVTVVALDDGGTARSTVPTSPADLGLRVNIGVRPEDLTVITEGGLF 297 Query: 291 AGVVELAEISGSDTFVHASTPWGD--LVAQLTGVHYFELGTAITLHLDPAQAYVFGA 345 GVVE+ E G T ++ + G+ +VA+L G+H + + L P + ++F A Sbjct: 298 TGVVEIVEALGEVTLLYFAAKPGEPHMVAKLPGIHAGLRHSTVGLTAAPEKVHLFHA 354 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 361 Length adjustment: 29 Effective length of query: 334 Effective length of database: 332 Effective search space: 110888 Effective search space used: 110888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory