Align ABC transporter for Glycerol, ATPase component 1 (characterized)
to candidate WP_110804244.1 C8J30_RS03245 ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_791 (363 letters) >NCBI__GCF_003217355.1:WP_110804244.1 Length = 332 Score = 186 bits (472), Expect = 8e-52 Identities = 116/348 (33%), Positives = 181/348 (52%), Gaps = 24/348 (6%) Query: 2 QLALDSISKKVGAQTWLYDMSLALQSGAVTVLLGATQAGKTSLMRIMAGLDAPTAGRVTV 61 ++ L ++K+ G + + LA+ G V +G + GK++L+R++AGL+ + G++ + Sbjct: 3 EIVLKGVTKRFGDVEVIPPIDLAIHDGEFVVFVGPSGCGKSTLLRLIAGLEDVSGGKIEI 62 Query: 62 DGKDVTGMPVRDRNVAMVYQQFINYPSMKVAANIASPLKLRG--EKNIDARVREIASRLH 119 DGKD T DR +AMV+Q + YP M V NIA PLK+ I+A+V+ A L+ Sbjct: 63 DGKDATETAPSDRGLAMVFQSYALYPHMSVKKNIAFPLKMAKLPPAEIEAKVQAAAKVLN 122 Query: 120 IDMFLDRYPAELSGGQQQRVALARALAKGAPLMLLDEPLVNLDYKLREELREELTQLFAA 179 + +LDR P +LSGGQ+QRVA+ RA+ + L DEPL NLD LR +R E+++L Sbjct: 123 LSAYLDRKPGQLSGGQRQRVAIGRAIVRSPEAFLFDEPLSNLDAALRVNMRLEISELHHT 182 Query: 180 GQSTVVYATTEPGEALLLGGYTAVLDEGQLLQYGPTAEVFHAPNSLRVARAFSDPPMNLM 239 ++T++Y T + EA+ + VL G++ Q G E++ P + VA P MN + Sbjct: 183 LKTTMIYVTHDQVEAMTMADKIVVLQAGRIEQVGSPLELYRTPRNRFVAGFIGSPKMNFI 242 Query: 240 AASATAQGVRLQGGAELTLPLPQGAATAAGLTVGVRASALRVHARPGDVSVAGVVELAEI 299 GAE AA +G+R +R+ G G V ++E Sbjct: 243 E------------GAE--------AAKHGAHAIGIRPEHIRISTTEG--MWKGTVGVSEH 280 Query: 300 SGSDTFVHASTPWGDLVAQLTGVHYFELGTAITLHLDPAQAYVFGADG 347 GSDTF+H +T G L + G G ++ L D AQ + F +G Sbjct: 281 LGSDTFLHVTTEHGLLNVRAGGEVDLHHGDSVFLSPDMAQLHRFDKEG 328 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 332 Length adjustment: 29 Effective length of query: 334 Effective length of database: 303 Effective search space: 101202 Effective search space used: 101202 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory