Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_110803758.1 C8J30_RS00370 ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >NCBI__GCF_003217355.1:WP_110803758.1 Length = 270 Score = 201 bits (510), Expect = 2e-56 Identities = 107/242 (44%), Positives = 150/242 (61%), Gaps = 4/242 (1%) Query: 4 VSIQAVSRVFETAKGQRTQALQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHATSG 63 VS++ + + F T L+ ++ V + + I+GPSGCGK+TLLR++AGL+ G Sbjct: 26 VSVRDLYKSF-TLNRAALAVLRGLNLSVAGGESLAIVGPSGCGKTTLLRVLAGLETPDRG 84 Query: 64 RVLLDGAPVEGPGAERGMVFQSYTLFPWLTIEQNIRFGLRERGMPEAQQKERAAYFIAKV 123 VL+DG PV G G ER +++Q L PW + N+ FGL RG P A+ +ERA +++ V Sbjct: 85 SVLIDGRPVVGVGTERAIIYQEPRLLPWANVLANVAFGLEVRGTPRARARERARHYLRLV 144 Query: 124 GLRGFEQHFPKQLSGGMQQRTAIARALANDPKILLMDEPFGALDNQTRVLMQELLLGIWE 183 GL FE P+QLSGGM QR IARAL P+ILL+DEP ALD T++ +QE L IW Sbjct: 145 GLEAFETALPRQLSGGMAQRVGIARALTVQPEILLLDEPLAALDAMTKLTVQEELARIWA 204 Query: 184 AERKTVLFVTHDIDEAIFMANRVAVFSARPGRIKTELAVDLPHPRHYTIKTSPEFMDLKA 243 E+ T++ VTHD++EAI++A+RV V S L V LP PR + +PEF+ L+ Sbjct: 205 EEKVTMILVTHDLEEAIYLADRVLVLSRETELPPRLLDVPLPRPRD---RNAPEFVALRR 261 Query: 244 RL 245 L Sbjct: 262 DL 263 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 270 Length adjustment: 25 Effective length of query: 234 Effective length of database: 245 Effective search space: 57330 Effective search space used: 57330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory