Align AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate WP_110803702.1 C8J30_RS00070 amino acid ABC transporter permease
Query= TCDB::Q52814 (384 letters) >NCBI__GCF_003217355.1:WP_110803702.1 Length = 344 Score = 235 bits (599), Expect = 2e-66 Identities = 139/348 (39%), Positives = 197/348 (56%), Gaps = 15/348 (4%) Query: 34 LLATPKDVILTILALALIAWAVPHLVNWLFIQAVWSGPDRTFCATTLQGGIQPDGWSGAC 93 L A + + L++ A+ L + L +WL +QA ++G D C GAC Sbjct: 12 LRADLRGLALSLAAVVLCLLVLRELADWLLVQATFAG-DMATCRAA----------EGAC 60 Query: 94 WAFISAKYDQFIFGRYPLGERWRPAIVGILFILLLVPMLIPSAPRKGLNAILLFAVLPVI 153 W F+ AK +F YP + WRP V + + L+ +P KGL A F + Sbjct: 61 WPFLVAKLRFILFAFYPTDQLWRPIAVIVGLLSLMGVSALPRFWGKGLLAGWGFGL--AA 118 Query: 154 AFWLLHGGFGLEVVETPLWGGLMVTLVLSFVGIAVSLPVGILLALGRRSRMPVIRMLCVT 213 A+ L+ GG GL V WGGL VTL+L + + P ILLAL R+SRM +R+L V Sbjct: 119 AWGLMSGGVGLVPVSVNDWGGLPVTLLLWASCMGFAFPAAILLALARQSRMGGLRVLSVL 178 Query: 214 FIEVIRGVPLITVLFMASVMLPLFLPTGWNVDKLLRALIGVSIFTSAYMAEVIRGGLQAI 273 +IEV+R P++ +L+ A ++LPL LP G DK+ RA I ++F +AY+AEV+RGGLQ I Sbjct: 179 YIEVMRATPMVAILYFAMLILPLGLPEGVIFDKITRAAIMTALFFTAYLAEVVRGGLQTI 238 Query: 274 PKGQFEGADSLGLGYWQKTRLIIMPQAIKLVIPSIVNTFIGTFKDTSLVTIIGMFDLLGI 333 P GQ E A +LG+GYW+ +L+I+PQA++ VIP +VN IG TSL+ +IG+FDLL Sbjct: 239 PPGQAEAAAALGIGYWRMVQLVILPQALQKVIPGLVNLAIGFLLATSLLAVIGVFDLLNA 298 Query: 334 VKLNFSDANWASAVTPITGLIFAGFIFWLFCFGMSRYSGFMERHLDTG 381 K +D W +F I++ CFG SRYS ++ER L G Sbjct: 299 AKAATTDPLWLGFHD--EAYLFVAAIYFALCFGGSRYSLWLERRLARG 344 Lambda K H 0.330 0.145 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 494 Number of extensions: 39 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 344 Length adjustment: 29 Effective length of query: 355 Effective length of database: 315 Effective search space: 111825 Effective search space used: 111825 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory