Align Short-chain acyl-CoA dehydrogenase (EC 1.3.8.1) (characterized)
to candidate WP_110803830.1 C8J30_RS00780 isovaleryl-CoA dehydrogenase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2983 (375 letters) >NCBI__GCF_003217355.1:WP_110803830.1 Length = 386 Score = 276 bits (707), Expect = 5e-79 Identities = 149/371 (40%), Positives = 220/371 (59%) Query: 5 DDQQQIRDMARDFAQERLKPFAAEWDREHRFPKEAIGEMAGLGFFGMLVPEQWGGCDTGY 64 +D +RDM + +A++RL P AA DR++ FP E EM LG G+ VPE++GG GY Sbjct: 12 EDIAALRDMVQAWARDRLAPIAARVDRDNLFPNELWPEMGALGLLGITVPEEYGGAGMGY 71 Query: 65 LAYAMALEEIAAGDGACSTIMSVHNSVGCVPILNYGTDEQKERFLKPLASGAMLGAFALT 124 LA+ +A EEIA + S H+++ + G+ EQK ++L L SGA +GA A++ Sbjct: 72 LAHVVATEEIARVSASISLSYGAHSNLCVNQLKLNGSPEQKRKYLPDLVSGAKIGALAMS 131 Query: 125 EPQAGSDASGLKTRARLEGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGKRGISAFIV 184 E AGSD G+K RA GD YVLNG K +IT+G +A ++V+A TDP AG +GI+AF++ Sbjct: 132 ETGAGSDVVGMKLRAEKRGDVYVLNGHKYWITNGCDADTLVVYAKTDPGAGSKGITAFLI 191 Query: 185 PTDSPGYKVARVEDKLGQHASDTCQILFEDVKVPLANRLGEEGEGYRIALANLEGGRVGI 244 G+ + DKLG S+T Q+ F++ +VP N LG EG+G R+ ++ L+ RV + Sbjct: 192 EKGMKGFSTSPHFDKLGMRGSNTAQLFFDNCEVPAENVLGAEGKGVRVLMSGLDYERVVL 251 Query: 245 ASQSVGMARAAFEAARDYARERESFGKPIIEHQAVAFRLADMATQIAVARQMVHYAAALR 304 + G+ A + YA+ RE FG+PI Q + ++ADM AR + A Sbjct: 252 SGIGTGILMACLDEVVPYAQTREQFGQPIGTFQLMQAKIADMYVAANTARAYTYEVAKAC 311 Query: 305 DSGKPALVEASMAKLFASEMAEKVCSSALQTLGGYGYLNDFPVERIYRDVRVCQIYEGTS 364 D G+ +A+ L+ASE A A+Q LGG G+LND V R++RD ++ +I GTS Sbjct: 312 DRGEVTRQDAAATVLYASEQAMVQAHQAVQALGGAGFLNDSTVSRLFRDAKLMEIGAGTS 371 Query: 365 DIQRMVISRNL 375 +I+RM+I R L Sbjct: 372 EIRRMLIGREL 382 Lambda K H 0.320 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 386 Length adjustment: 30 Effective length of query: 345 Effective length of database: 356 Effective search space: 122820 Effective search space used: 122820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory