Align 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) (characterized)
to candidate WP_110806794.1 C8J30_RS15730 acyl-CoA/acyl-ACP dehydrogenase
Query= reanno::pseudo6_N2E2:Pf6N2E2_1146 (375 letters) >NCBI__GCF_003217355.1:WP_110806794.1 Length = 547 Score = 229 bits (583), Expect = 2e-64 Identities = 142/383 (37%), Positives = 209/383 (54%), Gaps = 14/383 (3%) Query: 5 EEQTQIRDMARQFAEERLKPFAAEWD-REHRFPREAIDEMAELGFFGMLVPEQWGGCDTG 63 EE IR+ ++AEER+ P A EW ++ P E I+E+A+LG FG+ +PE++GG Sbjct: 165 EELEMIREQFHRYAEERVIPNAHEWHLKDELIPMEIIEELADLGVFGLTIPEEYGGLGLS 224 Query: 64 YLAYAMTLEEIAAGDGACSTIMSVHNSVGCVPILKFGNDEQKAKFLTPLASGAMLGAFAL 123 + + EE++ G ++ + + IL G +EQK K+L LASG +L Sbjct: 225 KASMVVVTEELSRGYIGVGSL-GTRSEIAAELILCGGTEEQKQKWLPGLASGQILSTAVF 283 Query: 124 TEPQAGSDASSLKTRARLEGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGK-RGISAF 182 TEP GSD SL+TRA EGD +V+ G K +IT Q V+ + A T+P RG+S F Sbjct: 284 TEPNTGSDLGSLRTRAVKEGDDWVITGNKTWITHAQRTHVMTLLARTEPDTTDWRGLSMF 343 Query: 183 IV---------PTDSPGYSVARVEDKLGQHASDTCQILFEDLKVPVGNRLG-EEGEGYKI 232 + P +PG + +E LG ++ F+ +V N LG E G G+K Sbjct: 344 LAEKTPGTDENPFPTPGMTGGEIE-VLGYRGMKEYELGFDGFRVKGENLLGGETGRGFKQ 402 Query: 233 ALANLEGGRVGIAAQAVGMARAAFEAARDYARERSSFGKPIIEHQAVAFRLADMATQIAV 292 + E R+ AA+AVG+A+AA E YA +R FGK +IE V +LA MA +I + Sbjct: 403 LMETFESARIQTAARAVGVAQAACEIGMRYAIDRKQFGKSLIEFPRVGGKLAMMAVEIMI 462 Query: 293 ARQMVHYAAALRDSGQPALVEASMAKLFASEMAEKVCSMALQTLGGYGYLNDFPLERIYR 352 ARQ+ +++A +D G VEA MAKL + +A ALQ GG G+ ++ + RI Sbjct: 463 ARQLTYFSAWEKDHGHRCDVEAGMAKLLGARVAWAASDNALQIHGGNGFALEYTISRILC 522 Query: 353 DVRVCQIYEGTSDIQRMVISRNL 375 D R+ I+EG ++IQ VI+R L Sbjct: 523 DARILNIFEGAAEIQAQVIARRL 545 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 449 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 547 Length adjustment: 33 Effective length of query: 342 Effective length of database: 514 Effective search space: 175788 Effective search space used: 175788 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory