Align L-arabinose 1-dehydrogenase; D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_110804245.1 C8J30_RS03250 L-iditol 2-dehydrogenase
Query= reanno::BFirm:BPHYT_RS16920 (266 letters) >NCBI__GCF_003217355.1:WP_110804245.1 Length = 253 Score = 102 bits (254), Expect = 8e-27 Identities = 84/258 (32%), Positives = 120/258 (46%), Gaps = 26/258 (10%) Query: 22 LVDRTVLITGGATGIGASFVEHFAAQGARVAFFDIDASAGEALADELGDSKHKPLFLSCD 81 L + LITG A GIG F E + +GA V DI+ + A E+G + + D Sbjct: 3 LQGKRALITGAARGIGRVFAESYLREGAHVTIGDINLEGAQKTAAEIGCAA-----VHLD 57 Query: 82 LTDIDALQKAIADVKAALGPIQVLVNNAANDKRHTIGEVTRESFDAGIAVNIRHQFFAAQ 141 +T ++ A+A ++A G I +L+NNAA I E+TR +D A+N+ F Q Sbjct: 58 VTSQASIDAAMASMRAG-GGIDILINNAAIFTAAPIDEITRNDYDRVFAINVAGTLFTLQ 116 Query: 142 AVMEDMKA-ANSGSIINLGSISWMLKNGGYPVYVMSKSAVQGLTRGLARDLGHFNIRVNT 200 A ++M A G IIN+ S + VY SK+AV LT+ +L I VN Sbjct: 117 AAAKEMIAQGRGGKIINMASQAGRRGESLVAVYCASKAAVISLTQSAGLNLIAHGINVNA 176 Query: 201 LVPGWVMTE------------KQKRLWLDDAGRRSIKEGQCIDAEL--EPADLARMALFL 246 + PG V E +QK L G++ + G + ADL MA+FL Sbjct: 177 IAPGVVDGEHWDGVDAFFAKYEQKPL-----GQKKKEVGASVPFGRMGTAADLTGMAIFL 231 Query: 247 AADDSRMITAQDIVVDGG 264 A ++ I AQ VDGG Sbjct: 232 ATPEADYIVAQTYNVDGG 249 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 253 Length adjustment: 24 Effective length of query: 242 Effective length of database: 229 Effective search space: 55418 Effective search space used: 55418 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory