Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_110806556.1 C8J30_RS14495 SDR family oxidoreductase
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >NCBI__GCF_003217355.1:WP_110806556.1 Length = 243 Score = 134 bits (336), Expect = 2e-36 Identities = 89/249 (35%), Positives = 127/249 (51%), Gaps = 15/249 (6%) Query: 18 RLKNKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAEKVETVAAHWRERGADVHALKA 77 R K L+TG GIG+AI A++ AR+ + R D A++A Sbjct: 3 RFAGKTALVTGGRSGIGQAIARRLAAEGARVFTAQ-------------RGPDPDFEAIEA 49 Query: 78 DVSNQQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWYGC 137 D+++ + + R G +DVLVN AGV M EDW R ++L + Sbjct: 50 DITDTDCPARVVSTVLARAGGLDVLVNNAGVMQEAGVEAMRLEDWDRTLRMNLTAPFLLI 109 Query: 138 KAVLPQMIEQGVGSIINIASTHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVNA 197 KA LP + Q G+I+NI S P Y +K GL GLTRA+ +++ + VR NA Sbjct: 110 KAALPAL-RQARGAIVNIGSIEGLGSNPLHAAYCASKAGLHGLTRAVAVDHGTE-VRCNA 167 Query: 198 IAPGYIETQLNVDYWNGFADPYAERQRALDLHPPRRIGQPIEVAMTAVFLASDEAPFINA 257 +APG+I+T+LN + N DP A R +HP R G+P EVA +LAS+EA F++ Sbjct: 168 VAPGWIDTELNEAFVNAMPDPVAFRANIGRIHPVGRTGRPEEVAALVAWLASEEAGFVSG 227 Query: 258 SCITIDGGR 266 T+DGGR Sbjct: 228 QVWTLDGGR 236 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 243 Length adjustment: 24 Effective length of query: 248 Effective length of database: 219 Effective search space: 54312 Effective search space used: 54312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory