Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_110805339.1 C8J30_RS08100 ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_003217355.1:WP_110805339.1 Length = 348 Score = 202 bits (513), Expect = 1e-56 Identities = 113/275 (41%), Positives = 168/275 (61%), Gaps = 10/275 (3%) Query: 16 GKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKL 75 G + + + N+ +E GE +LGPSG GKTT +R++AG ++P++G + + V Sbjct: 14 GTLRVVKDFNLTVEKGEFISLLGPSGCGKTTVLRMVAGFELPTSGAITIAGKEVTD---- 69 Query: 76 IVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLN 135 + P R IGMVFQ +AL+PNLT +N+ F L K I KRVEE+ ++ + + N Sbjct: 70 -LKPNQRNIGMVFQAYALFPNLTVAQNVGFGLKVKGTPKAAIDKRVEEMLSLIGLPDLGN 128 Query: 136 HFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLL 195 +P +LSGGQQQRVALARAL PS+LLLDEP S LDA++R S R ++ +Q LG+T + Sbjct: 129 RYPFQLSGGQQQRVALARALAPKPSVLLLDEPLSALDAKVRVSLRNEIRAIQRELGITTI 188 Query: 196 VVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKV---T 252 V+HD + +++DRV V+ +G QVG P D+Y+ P + VAS +G +N L +V Sbjct: 189 FVTHDQEEALSMSDRVVVMHEGIADQVGTPFDIYNRPSTRFVASFVGTLNTLNVQVLDAA 248 Query: 253 NEGVVIGSLRFPV--SVSSDRAIIGIRPEDVKLSK 285 N V +G+ + S+ S +G+RPE V L + Sbjct: 249 NGRVKLGATEIALGRSLPSGPVTLGLRPEAVTLGQ 283 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 348 Length adjustment: 29 Effective length of query: 324 Effective length of database: 319 Effective search space: 103356 Effective search space used: 103356 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory