Align LacK, component of Lactose porter (characterized)
to candidate WP_110804036.1 C8J30_RS01990 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q01937 (363 letters) >NCBI__GCF_003217355.1:WP_110804036.1 Length = 361 Score = 341 bits (875), Expect = 2e-98 Identities = 186/358 (51%), Positives = 242/358 (67%), Gaps = 5/358 (1%) Query: 1 MAEVRLTDIRKSYGSLEVIKGVNLEVSSGEFVVFVGPSGCGKSTLLRMIAGLEDISSGEL 60 MA+++LT + KSYG ++V++ +NL++ +GE +VFVGPSGCGKSTLLRMIAGLE IS+GEL Sbjct: 1 MADLKLTRVGKSYGEVDVLRDINLDIKAGELIVFVGPSGCGKSTLLRMIAGLERISAGEL 60 Query: 61 TIGGTVMNDVDPSKRGIAMVFQTYALYPHMTVRENMGFALRFAGMAKDEIERRVNAAAKI 120 I G +ND+ P++RGIAMVFQ+YALYPHMTVR+NM FAL+ A + +I++ V AA+I Sbjct: 61 RIDGVRVNDMPPAQRGIAMVFQSYALYPHMTVRQNMEFALKIAKKTRQDIDKAVENAARI 120 Query: 121 LELDALMDRKPKALSGGQRQRVAIGRAIVRQPDVFLFDEPLSNLDAELRVHMRVEIARLH 180 L+L +DR PKALSGGQRQRVAIGRAIVR P V+LFDEPLSNLDA LRV R+EIA+L Sbjct: 121 LQLTPYLDRLPKALSGGQRQRVAIGRAIVRDPKVYLFDEPLSNLDAALRVATRIEIAQLK 180 Query: 181 KEL-NATIVYVTHDQVEAMTLADKIVVMRGGIVEQVGAPLALYDDPDNMFVAGFIGSPRM 239 + + T++YVTHDQVEAMTLA +IVV+ + QVG PL LY+ P+ FVA FIGSP+M Sbjct: 181 EAMPERTMIYVTHDQVEAMTLASRIVVLANKGIAQVGTPLELYEKPETEFVAQFIGSPQM 240 Query: 240 NFLPAVVIGQAEGGQVTVALKARPDTQLTVACATPPQGGDAVTVGVRPEHFLPAGSGDTQ 299 N LP V+ E G VTV T + +P G V +GVRPE G Sbjct: 241 NLLPGVI---RETGAVTVVALDDGGTARSTVPTSPADLGLRVNIGVRPEDLTVITEGGL- 296 Query: 300 LTAHVDVVEHLGNTSYVYAHTVPGEQIIIEQEERRHGGRYGDEIAVGISAKTSFLFDA 357 T V++VE LG + +Y PGE ++ + H G + + + + LF A Sbjct: 297 FTGVVEIVEALGEVTLLYFAAKPGEPHMVAKLPGIHAGLRHSTVGLTAAPEKVHLFHA 354 Lambda K H 0.320 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 361 Length adjustment: 29 Effective length of query: 334 Effective length of database: 332 Effective search space: 110888 Effective search space used: 110888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory