Align ABC transporter for Lactose, ATPase component (characterized)
to candidate WP_110804244.1 C8J30_RS03245 ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b20002 (358 letters) >NCBI__GCF_003217355.1:WP_110804244.1 Length = 332 Score = 343 bits (879), Expect = 5e-99 Identities = 194/359 (54%), Positives = 236/359 (65%), Gaps = 29/359 (8%) Query: 1 MSELQLSDVRKSYGGLEVIKGVDLDIKSGEFVVFVGPSGCGKSTLLRMIAGLEEISSGDL 60 M E+ L V K +G +EVI +DL I GEFVVFVGPSGCGKSTLLR+IAGLE++S G + Sbjct: 1 MGEIVLKGVTKRFGDVEVIPPIDLAIHDGEFVVFVGPSGCGKSTLLRLIAGLEDVSGGKI 60 Query: 61 TIDDVRMNDVDPSKRGIAMVFQSYALYPHMTVRENMGFALRFAGVPRAEIEKRVNEAAHI 120 ID + PS RG+AMVFQSYALYPHM+V++N+ F L+ A +P AEIE +V AA + Sbjct: 61 EIDGKDATETAPSDRGLAMVFQSYALYPHMSVKKNIAFPLKMAKLPPAEIEAKVQAAAKV 120 Query: 121 LELGALLDRKPKQLSGGQRQRVAIGRAIVRHPKIFLFDEPLSNLDAELRVHMRIEIARLH 180 L L A LDRKP QLSGGQRQRVAIGRAIVR P+ FLFDEPLSNLDA LRV+MR+EI+ LH Sbjct: 121 LNLSAYLDRKPGQLSGGQRQRVAIGRAIVRSPEAFLFDEPLSNLDAALRVNMRLEISELH 180 Query: 181 KQLATTIVYVTHDQVEAMTLADKIVVMRAGVVEQVGSPLDLYDDPANLFVAGFIGSPKMN 240 L TT++YVTHDQVEAMT+ADKIVV++AG +EQVGSPL+LY P N FVAGFIGSPKMN Sbjct: 181 HTLKTTMIYVTHDQVEAMTMADKIVVLQAGRIEQVGSPLELYRTPRNRFVAGFIGSPKMN 240 Query: 241 FLKGVIEIDEDQAYARLPDYGDAKIPVTLQAAAGTAVTIGIRPEHFDEAGPAAL-DLAID 299 F++G +AA A IGIRPEH + + + Sbjct: 241 FIEGA------------------------EAAKHGAHAIGIRPEHIRISTTEGMWKGTVG 276 Query: 300 MLEHLGGETFAY-ARHHGNGELIVVETKNGRGLKTGDRLTARFDPVSVLVFDGEGKRLR 357 + EHLG +TF + HG L+ V L GD + D + FD EG L+ Sbjct: 277 VSEHLGSDTFLHVTTEHG---LLNVRAGGEVDLHHGDSVFLSPDMAQLHRFDKEGGALK 332 Lambda K H 0.321 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 332 Length adjustment: 29 Effective length of query: 329 Effective length of database: 303 Effective search space: 99687 Effective search space used: 99687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory