Align Isovaleryl-CoA dehydrogenase (EC 1.3.8.4) (characterized)
to candidate WP_110804512.1 C8J30_RS04420 acyl-CoA dehydrogenase
Query= reanno::acidovorax_3H11:Ac3H11_2991 (396 letters) >NCBI__GCF_003217355.1:WP_110804512.1 Length = 406 Score = 202 bits (515), Expect = 1e-56 Identities = 127/382 (33%), Positives = 198/382 (51%), Gaps = 12/382 (3%) Query: 10 LNFQLGEDIDALRDAVRDFAQAEIAPRAADIDKSDQFPMDLWRKMGDLGVLGITVPEQYG 69 LN QL E+ LRDA R +AQ ++ PR ++ ++R+MG++G+LG+T+PE+YG Sbjct: 26 LNGQLTEEERMLRDAARAYAQEKLQPRVIRAFAEEETDPAIFREMGEMGLLGVTIPEEYG 85 Query: 70 GAAMGYLAHMVAMEEISRASASVGLSYGAHSNLCVNQINRNGNEAQKAKYLSKLISGEHV 129 G Y+A+ + EI R + S+L + I G E Q+ KYL KL SGE + Sbjct: 86 GLGASYVAYGLVAREIERVDSGYRSMMSVQSSLVMYPIYAYGTEEQRRKYLPKLASGEWI 145 Query: 130 GALAMSEPGAGSDVISMKLKAEDKGGYYLLNGSKMWITNGPDADTLVVYAKTEPELGARG 189 G ++EP AGSD S+K A+ Y+L GSKMWI+N P AD VV+AK+E G Sbjct: 146 GCFGLTEPDAGSDPASLKTVAKKTANGYVLTGSKMWISNAPIADVFVVWAKSEAHGGK-- 203 Query: 190 VTAFLIEKGMKGFSIAQKLDKLGMRGSHTGELVFQDVEVPAENVLGGLNQGAKVLMSGLD 249 + F++EKG+KG S + KL +R S TGE+V VEV + +L G+ +G K L+ Sbjct: 204 IKGFVLEKGLKGLSAPKIAGKLSLRASITGEIVMDGVEVGEDALLPGV-EGLKGPFGCLN 262 Query: 250 YERAVLTGGPLGIMQSVMDNVIPYIHDRKQFGQSIGEFQLIQGKVADMYTVLQAGRSFAY 309 R + G +G + Y DRKQF + + + QL Q K+A+M T + G Sbjct: 263 RARYGIAWGVMGAAEFCFHAARQYGLDRKQFNKPLAQTQLYQLKLANMLTDITLGLQACL 322 Query: 310 TVAKNLD--MLGTDHVRQVRKDCASVILWCAEKATWMAGEGVQIYGGNGYINEYPLGRLW 367 V + +D + + ++++ L A A ++GGNG + + R Sbjct: 323 QVGRLMDDANAAPEMISLIKRNNCGKALEAARHAR-------DMHGGNGISESFQVIRHM 375 Query: 368 RDAKLYEIGAGTSEIRRMLIGR 389 + + GT ++ +++GR Sbjct: 376 VNLETVNTYEGTHDVHALILGR 397 Lambda K H 0.318 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 415 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 406 Length adjustment: 31 Effective length of query: 365 Effective length of database: 375 Effective search space: 136875 Effective search space used: 136875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory