Align 5-aminopentanamidase (EC 3.5.1.30) (characterized)
to candidate WP_110804393.1 C8J30_RS03730 carbon-nitrogen hydrolase family protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_4777 (264 letters) >NCBI__GCF_003217355.1:WP_110804393.1 Length = 276 Score = 79.0 bits (193), Expect = 1e-19 Identities = 86/276 (31%), Positives = 124/276 (44%), Gaps = 28/276 (10%) Query: 1 MRVALYQCPPLPLDPAGNL----HRLHQVALEARGADVLVLPEMFMTGYNIGVDAVNVLA 56 MR AL Q + DPA NL + Q A A GA ++ PE + VLA Sbjct: 1 MRAALVQLS-VSEDPAANLPVTVEFIRQAA--AGGAGFVLTPECTNLLSSDRAHQRAVLA 57 Query: 57 EVYNGEWAQQIARIAKAAGLAIVYG---YPERGEDGQIYNAVQLIDAQGERLANYRKSHL 113 + + A+ GL ++ G DG+ N LI G+ +A Y K H+ Sbjct: 58 HEEDDATLAALRAEAERLGLWLLIGSLGLKTHDADGRFANRSFLIGPAGQIVARYDKIHM 117 Query: 114 FGDLDHA---------MFSAGDAALPIVELNGWKLGLLICYDLEFPENARRLALAGAELI 164 F D+D + + G +A+ + + KLG+ ICYDL FP+ RRL+ AGA ++ Sbjct: 118 F-DVDVSPTERYRESEAYRPGTSAV-LADAGFAKLGMAICYDLRFPQLFRRLSQAGANVL 175 Query: 165 LVPTA-NMQPYEFIADVTVRARAIENQCFVAYANYCG----HEGELQYC-GQSSIAAPNG 218 +P A N + +RARAIEN CFV CG H G+ + G S AP G Sbjct: 176 TLPAAFNDTTGAAHWESLIRARAIENTCFVLAPAQCGTHAAHAGKPRRTHGHSLAVAPWG 235 Query: 219 SRPALAGLDEALIVAELDRQLMDDSRAAY-NYLHDR 253 A G + + +LD + ++RA + HDR Sbjct: 236 EVLADGGTEPGVTFVDLDLARVAEARARVPSITHDR 271 Lambda K H 0.321 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 276 Length adjustment: 25 Effective length of query: 239 Effective length of database: 251 Effective search space: 59989 Effective search space used: 59989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory