Align L-lysine-epsilon aminotransferase; L-lysine aminotransferase; EC 2.6.1.36; Lysine 6-aminotransferase (uncharacterized)
to candidate WP_110806203.1 C8J30_RS11905 aspartate aminotransferase family protein
Query= curated2:Q05174 (450 letters) >NCBI__GCF_003217355.1:WP_110806203.1 Length = 393 Score = 118 bits (296), Expect = 3e-31 Identities = 110/409 (26%), Positives = 173/409 (42%), Gaps = 51/409 (12%) Query: 43 GPWLVDAVTGTRYLDLFSFFASAPLGINPSCIVDDPAFVGELAAAAVNKPSNPDVYTVPY 102 G WL G+RYLDL + A LG P V L A ++Y +P Sbjct: 21 GSWLWTE-DGSRYLDLGAGIAVNALGHAA------PELVATLTEQAGKLWHVSNLYRIPE 73 Query: 103 AKFVTTFARVLGDPLLPHLFFVDGGALAVENALKAAFDWKAQKLGLDDRAVNRLQVLHLE 162 + + ++ + +FF + G A E A+K + +K G +R+ +L Sbjct: 74 QERLADM--LVANTFADTVFFTNSGTEACELAVKMVRKYFYEK-GQPERS----DILTFS 126 Query: 163 RSFHGRSGYTMSLTNTDPSKTARYPKFDWPRIPAPALEHPLTTHAEANREAERRALEAAE 222 +FHGRS ++ T+ P P +H EA + Sbjct: 127 GAFHGRSSAAIAAAGTEKMVKGFGPLL-------PGFKHLPWGDLEAVK----------- 168 Query: 223 EAFRAADGMIACFLAEPIQGEGGDNHFSAEFLQAMQDLCHRHDALFVLDEVQSGCGLTGT 282 A A L EPIQGEGG FL+A++++C L V DEVQ G TG Sbjct: 169 ---AAVTDTTAAILIEPIQGEGGIRPAPEGFLKALREICDATGTLLVFDEVQCGVARTGR 225 Query: 283 AWAYQQLGLRPDLVAFGKKTQVCGVMGGGRIGEVESNVFAVSSRIS----STWGGNLADM 338 +A++ G+ PD++ K G+ GG +G V + A S + ST+GGN Sbjct: 226 LFAHEWAGVTPDVMMVAK-----GIGGGFPLGAVLATANAASGMTAGTHGSTYGGNPLGC 280 Query: 339 VRATRVLETIERTDLLDSVVQRGKYLRDGLEALAERHPGVVTNARGRGLMCAV--DLPDT 396 +++E + L+ V ++ +LR LE L HP + RG+GLM + LP Sbjct: 281 AIGAKMIEIVTAPGFLEEVSRKAGFLRQRLEGLVAAHPDIFEEVRGQGLMLGLRCKLPPG 340 Query: 397 EQRDAVLRRMYTGHQVIALPCGTRGLRFRPPLTVTESELDQGLEALAAS 445 + V++ Y ++ +P LR P LT+TE ++ + + L A+ Sbjct: 341 D----VVKAAY-AQNLLTVPAADNVLRLLPALTITEDDMAEAVRRLEAA 384 Lambda K H 0.321 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 450 Length of database: 393 Length adjustment: 32 Effective length of query: 418 Effective length of database: 361 Effective search space: 150898 Effective search space used: 150898 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory