Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate WP_110804034.1 C8J30_RS01980 carbohydrate ABC transporter permease
Query= uniprot:C8WUQ9 (301 letters) >NCBI__GCF_003217355.1:WP_110804034.1 Length = 382 Score = 102 bits (254), Expect = 1e-26 Identities = 73/234 (31%), Positives = 120/234 (51%), Gaps = 11/234 (4%) Query: 74 PSNASLANYKALFQGGQFWTWVRNSLVVGVVVAMAQSFITAMSAFAFSKLRFYGRKYGLM 133 P + NY + N++ V + + I A +A+A + +RF GR + Sbjct: 153 PPRLTTGNYARVITAEGIGRAFLNTMTVTIPATVIPILIAAFAAYALAWMRFPGRALLVA 212 Query: 134 TLLLLQMFPNILAIAAFYTALAKL-NMIDMLGSYILVMLGTSAFN----IWLLKGYMDSV 188 T++ L + P LA+ L KL N I + SY+ + L + F I+LL+ YM + Sbjct: 213 TIVGLLVVPLQLALIP----LLKLHNQIGLNQSYLGIWLAHTGFGLPLAIYLLRNYMVGL 268 Query: 189 PKELDEAAVIDGATTWQRFIHVTLPLSTPMMVVIFFLTLVGIFSEYMFAGTILQSPWNYT 248 P+E+ E+A +DGAT +Q F + LPLS P + + ++++ + A L + + Sbjct: 269 PREIIESARVDGATEFQIFRRIVLPLSFPALASFAIFQFLWVWNDLLVATVFLGNATDTQ 328 Query: 249 LGVGMYNLISGQFAKNWGEFAAAALLS-AVPLAIVFAVAQRYLTKGLVAGSVKG 301 + G + G +W AA+A +S AVPL + FA+ Q+YL +GL+AGSVKG Sbjct: 329 VMTGALRALLGSRGGDWEILAASAFVSIAVPLIVFFAL-QKYLVRGLLAGSVKG 381 Lambda K H 0.328 0.136 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 382 Length adjustment: 28 Effective length of query: 273 Effective length of database: 354 Effective search space: 96642 Effective search space used: 96642 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory