Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_110804244.1 C8J30_RS03245 ABC transporter ATP-binding protein
Query= BRENDA::Q70HW1 (384 letters) >NCBI__GCF_003217355.1:WP_110804244.1 Length = 332 Score = 305 bits (782), Expect = 9e-88 Identities = 172/364 (47%), Positives = 226/364 (62%), Gaps = 37/364 (10%) Query: 1 MARVLLEHIYKTYPGQTEPTVKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEG 60 M ++L+ + K + G E + +L I D EF VFVGPSGCGK+T LR+IAGLED++ G Sbjct: 1 MGEIVLKGVTKRF-GDVE-VIPPIDLAIHDGEFVVFVGPSGCGKSTLLRLIAGLEDVSGG 58 Query: 61 NLYIGDRRVNDVPPKDRDIAMVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAA 120 + I + + P DR +AMVFQ+YALYPHM+V +N+AF LK+ K+P AEI+ +VQ AA Sbjct: 59 KIEIDGKDATETAPSDRGLAMVFQSYALYPHMSVKKNIAFPLKMAKLPPAEIEAKVQAAA 118 Query: 121 KILDIAHLLDRKPKALSGGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRK 180 K+L+++ LDRKP LSGGQRQRVA+GRAIVR P+ FL DEPLSNLDA LRV MR EI + Sbjct: 119 KVLNLSAYLDRKPGQLSGGQRQRVAIGRAIVRSPEAFLFDEPLSNLDAALRVNMRLEISE 178 Query: 181 LHQRLQTTVIYVTHDQTEAMTMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFIGSPA 240 LH L+TT+IYVTHDQ EAMTM D+IVV++ G I+Q +P +Y P+N FVAGFIGSP Sbjct: 179 LHHTLKTTMIYVTHDQVEAMTMADKIVVLQAGRIEQVGSPLELYRTPRNRFVAGFIGSPK 238 Query: 241 MNFIRGEIVQDGDAFYFRAPSISLRLPEGRYGVLKASGAIGKPVVLGVRPEDLHDEEVFM 300 MNFI G A A +G+RPE + Sbjct: 239 MNFIEG-----------------------------AEAAKHGAHAIGIRPEHIR----IS 265 Query: 301 TTYPDSVLQMQVEVVEHMGSEVYLHTSIGPNTIVARVNPRHVYHVGSSVKLAIDLNKIHI 360 TT + + + V V EH+GS+ +LH + + R H G SV L+ D+ ++H Sbjct: 266 TT--EGMWKGTVGVSEHLGSDTFLHVTTEHGLLNVRAGGEVDLHHGDSVFLSPDMAQLHR 323 Query: 361 FDAE 364 FD E Sbjct: 324 FDKE 327 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 332 Length adjustment: 29 Effective length of query: 355 Effective length of database: 303 Effective search space: 107565 Effective search space used: 107565 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory