Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_110804036.1 C8J30_RS01990 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= BRENDA::Q8NMV1 (376 letters) >NCBI__GCF_003217355.1:WP_110804036.1 Length = 361 Score = 270 bits (689), Expect = 6e-77 Identities = 158/306 (51%), Positives = 202/306 (66%), Gaps = 19/306 (6%) Query: 21 VKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDGAIFIGDKDVTHVAPRDRDIA 80 ++ NL+I GE +V VGPSGCGKST LRM+AGLE ++ G + I V + P R IA Sbjct: 19 LRDINLDIKAGELIVFVGPSGCGKSTLLRMIAGLERISAGELRIDGVRVNDMPPAQRGIA 78 Query: 81 MVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAAATLGLTEFLERKPKALSGGQ 140 MVFQ+YALYPHMTV +NM FALKIA K++ +I+K V+ AA L LT +L+R PKALSGGQ Sbjct: 79 MVFQSYALYPHMTVRQNMEFALKIAKKTRQDIDKAVENAARILQLTPYLDRLPKALSGGQ 138 Query: 141 RQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQRKLGV-TTVYVTHDQTEA 199 RQRVA+GRAIVR+P+V+L DEPLSNLDA LRV TR +IA L+ + T +YVTHDQ EA Sbjct: 139 RQRVAIGRAIVRDPKVYLFDEPLSNLDAALRVATRIEIAQLKEAMPERTMIYVTHDQVEA 198 Query: 200 LTMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPAMNLGTFSVKDGDATS---- 255 +T+ RI VL + + QVG P ELY++P FVA FIGSP MNL +++ A + Sbjct: 199 MTLASRIVVLANKGIAQVGTPLELYEKPETEFVAQFIGSPQMNLLPGVIRETGAVTVVAL 258 Query: 256 ---GHARIKLSPETLAAMTPEDNG-RITIGFRPEALEIIPEGESTDLSIPIKLDFVEELG 311 G AR + +P D G R+ IG RPE L +I EG L + ++ VE LG Sbjct: 259 DDGGTAR------STVPTSPADLGLRVNIGVRPEDLTVITEG---GLFTGV-VEIVEALG 308 Query: 312 SDSFLY 317 + LY Sbjct: 309 EVTLLY 314 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 361 Length adjustment: 30 Effective length of query: 346 Effective length of database: 331 Effective search space: 114526 Effective search space used: 114526 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory