Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate WP_110805878.1 C8J30_RS10880 ABC transporter permease
Query= uniprot:D8IZC8 (344 letters) >NCBI__GCF_003217355.1:WP_110805878.1 Length = 352 Score = 223 bits (567), Expect = 7e-63 Identities = 139/342 (40%), Positives = 199/342 (58%), Gaps = 22/342 (6%) Query: 21 SSTTAQWLLHRLGMLPVLVVLYL-LFYGLTLYLSGDGTSNFASAENTMNILRQVAINLVL 79 +ST AQ L +L L L L +G +++ NF S N++ + + A+ L Sbjct: 6 ASTPAQGSPLLLTLLQARTYLALILVFGFFAFMA----PNFLSVANSVIVAKHAALTAFL 61 Query: 80 AAGMTFVILTAGIDLSVGSVLAVSAVLGMQVSLGAAPGWAIPMFIFS-----------GL 128 A GMTFVI+T GIDLSVGS + + A++ + L A+ F+ G+ Sbjct: 62 AIGMTFVIITGGIDLSVGSTVGLCAMVSGWLILYGIDLGAMGTMQFNTLEIALLVMCVGV 121 Query: 129 VMGMVNGAMVALLNINAFVVTLGTMTAFRGAAYLLADGTTVLNND------IPSFEWIGN 182 +G VNG ++ LN+ F+ TLGT+ RGAA L + G T N SF IG Sbjct: 122 FVGFVNGILITKLNVAPFIATLGTLYIARGAALLSSGGRTFPNLSGNADYGSASFPGIGA 181 Query: 183 GDFLHVPWLIWVAVAVVLLSWVILRKTVLGMHIYAIGGNLQAARLTGIRVGLVLLFVYSI 242 G FL +P IW+ +AV L++ I ++T LG HIYA+GGN + A L+G++V V LFVY Sbjct: 182 GTFLGLPVQIWMLIAVGLVAAYIAKRTPLGRHIYAVGGNERGAALSGVKVNRVKLFVYMF 241 Query: 243 SGLFSGLAGAMSASRLYGANGNWGSGYELDAIAAVVLGGTSLMGGVGSIWGTVVGALIIG 302 SG + + G + AS+L A+ G +EL+AIAA VLGGTSL GG G I GT+VGA +I Sbjct: 242 SGFCAAIVGLIIASQLQAAHPATGETFELNAIAAAVLGGTSLSGGRGKIGGTIVGAFVIS 301 Query: 303 VMNNGLTILGLSSFWQYVAKGAVIVLAVILDKWRQKDAAQSA 344 ++++GL ++ +SSFWQ V KG VIV AV++D+ + K A+ A Sbjct: 302 ILSDGLVMMSVSSFWQTVIKGLVIVAAVVIDQAQSKLQARVA 343 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 352 Length adjustment: 29 Effective length of query: 315 Effective length of database: 323 Effective search space: 101745 Effective search space used: 101745 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory