Align Inositol transport system ATP-binding protein (characterized)
to candidate WP_110806370.1 C8J30_RS13475 sugar ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF717 (261 letters) >NCBI__GCF_003217355.1:WP_110806370.1 Length = 267 Score = 173 bits (438), Expect = 4e-48 Identities = 96/245 (39%), Positives = 149/245 (60%), Gaps = 6/245 (2%) Query: 5 QPLIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDI 64 +P++R++G+ K FG+V AL+ + +DV GE L+GDNGAGKST IK ++GV +PT G I Sbjct: 13 EPILRLRGVTKTFGAVSALSDIDLDVHAGEVVALVGDNGAGKSTLIKILAGVFQPTSGTI 72 Query: 65 LFEGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYA 124 F G+P+ P A+ GI+TV Q L++ + V N F+G E + P L + Sbjct: 73 EFMGRPVSIDSPSAALTLGISTVFQDLSLCENLDVVANLFLGQE----LSPWALDEVQME 128 Query: 125 NRITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQT 184 R + + ++ + + + +LSGG+RQTVAIAR++ K+++LDEPT+ALGV QT Sbjct: 129 VR-AWQLLGELAARIPSVREPIASLSGGQRQTVAIARSLLLEPKIVMLDEPTAALGVAQT 187 Query: 185 ANVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEELQDMM 244 A VL I+++R +G V+ I+HN+ + AV DR VL G+ GT D + E++ + Sbjct: 188 AEVLNLIERLRDRGYGVILISHNMDNVRAVSDRIAVLRLGRNNGTF-TADATREQIVAAI 246 Query: 245 AGGQE 249 G + Sbjct: 247 MGADD 251 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 267 Length adjustment: 25 Effective length of query: 236 Effective length of database: 242 Effective search space: 57112 Effective search space used: 57112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory