Align cyclohex-1-ene-1-carbonyl-CoA dehydrogenase (EC 1.3.8.10) (characterized)
to candidate WP_110806794.1 C8J30_RS15730 acyl-CoA/acyl-ACP dehydrogenase
Query= BRENDA::Q39QF5 (380 letters) >NCBI__GCF_003217355.1:WP_110806794.1 Length = 547 Score = 184 bits (468), Expect = 4e-51 Identities = 131/387 (33%), Positives = 198/387 (51%), Gaps = 15/387 (3%) Query: 4 LTEEQKLTLDMVRDVATREIAPRALELDEKS-LFPEYARDLFAKLGLLNPLLPAAYGGTE 62 L EE ++ + A + P A E K L P + A LG+ +P YGG Sbjct: 163 LDEELEMIREQFHRYAEERVIPNAHEWHLKDELIPMEIIEELADLGVFGLTIPEEYGGLG 222 Query: 63 MGVLTLALILEELGRVCASTALLLIAQTDGMLPIIHGGSPELKERYLRRFAGESTLLTAL 122 + ++ ++ EEL R L I+ GG+ E K+++L A L TA+ Sbjct: 223 LSKASMVVVTEELSRGYIGVGSLGTRSEIAAELILCGGTEEQKQKWLPGLASGQILSTAV 282 Query: 123 AATEPAAGSDLLAMKTRAVRQGDKYVINGQKCFITNGSVADVIVVYAYTDPEKGS-KGIS 181 TEP GSDL +++TRAV++GD +VI G K +IT+ V+ + A T+P+ +G+S Sbjct: 283 F-TEPNTGSDLGSLRTRAVKEGDDWVITGNKTWITHAQRTHVMTLLARTEPDTTDWRGLS 341 Query: 182 AFVVEKG---------TPGLVYGRNESKMGMRGSINSELFFENMEVPAENIIGAE-GTGF 231 F+ EK TPG+ G E +G RG EL F+ V EN++G E G GF Sbjct: 342 MFLAEKTPGTDENPFPTPGMTGGEIEV-LGYRGMKEYELGFDGFRVKGENLLGGETGRGF 400 Query: 232 ANLMQTLSTNRVFCAAQAVGIAQGALDIAVRHTQDRVQFGKPIAHLAPVQFMVADMATAV 291 LM+T + R+ AA+AVG+AQ A +I +R+ DR QFGK + V +A MA + Sbjct: 401 KQLMETFESARIQTAARAVGVAQAACEIGMRYAIDRKQFGKSLIEFPRVGGKLAMMAVEI 460 Query: 292 EASRLLTRKAAELLDDGDKKAVLYGSMAKTMASDTAMRVTTDAVQVLGGSGYMKENGVER 351 +R LT +A D G + V G MAK + + A + +A+Q+ GG+G+ E + R Sbjct: 461 MIARQLTYFSAWEKDHGHRCDVEAG-MAKLLGARVAWAASDNALQIHGGNGFALEYTISR 519 Query: 352 MMRDAKLTQIYTGTNQITRMVTGRALL 378 ++ DA++ I+ G +I V R LL Sbjct: 520 ILCDARILNIFEGAAEIQAQVIARRLL 546 Lambda K H 0.319 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 547 Length adjustment: 33 Effective length of query: 347 Effective length of database: 514 Effective search space: 178358 Effective search space used: 178358 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory