Align benzoyl-CoA reductase (EC 1.3.7.8) (characterized)
to candidate WP_110803698.1 C8J30_RS00045 CoA activase
Query= BRENDA::Q8VUG1 (269 letters) >NCBI__GCF_003217355.1:WP_110803698.1 Length = 283 Score = 149 bits (377), Expect = 5e-41 Identities = 91/268 (33%), Positives = 142/268 (52%), Gaps = 16/268 (5%) Query: 3 TAGIDMGSRSVKVVLLEQIKVEGAKAPSFAVKKAHLMLPGDLDADQAAEKAFDAALAEAG 62 T GID+GSR K VLL+ +V S +DA A++ L ++G Sbjct: 20 TIGIDIGSRQAKAVLLDDAEVHTVITAS------------GVDAQDTADRLVKKLLRQSG 67 Query: 63 VTRDQVKSVFATGAGR---GQVAFATEGITEMTAGARGAVFMYPQARTVVDVGAEEGRGI 119 R + V TG GR G T+ +TE++ A GA F+ R+++D+G ++ + I Sbjct: 68 RDRADIAYVVGTGYGRIALGYDDIPTQIVTEISCHAMGAHFLNAGTRSIIDIGGQDSKAI 127 Query: 120 KTDPD-GKAIDFAGNEKCAAGAGSFAEAMSRALQLSLKEFGEASLRSDKSIPMNAQCTVF 178 K DPD G+ +F N+KCAAG G F E ++ L L E G+ +L +++ +++QC VF Sbjct: 128 KVDPDTGRVREFVMNDKCAAGTGRFLEKIAELLDYRLDELGDRALEAEERATISSQCVVF 187 Query: 179 AESEVVSLIHSSTPKEDIAKAVLDAVASRVCAMVRRVGIEGNVVLIGGMGHNPGFVQSLK 238 AESEV+SL T +EDIA + A A RV +V R+G++ +V GG+ +N G ++L+ Sbjct: 188 AESEVISLKVRGTRREDIAAGIHYASARRVRNLVNRIGLDPEIVFTGGVSNNKGMKRALE 247 Query: 239 TAMDVDQVLLPELPEFVSALGCALIAAE 266 + + ALG A+IA + Sbjct: 248 DLIGAPISETKLDTTYAGALGAAVIAQQ 275 Lambda K H 0.317 0.131 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 269 Length of database: 283 Length adjustment: 25 Effective length of query: 244 Effective length of database: 258 Effective search space: 62952 Effective search space used: 62952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory