Align benzoyl-CoA reductase (EC 1.3.7.8) (characterized)
to candidate WP_110803699.1 C8J30_RS00050 hypothetical protein
Query= BRENDA::Q8VUG1 (269 letters) >NCBI__GCF_003217355.1:WP_110803699.1 Length = 669 Score = 148 bits (373), Expect = 3e-40 Identities = 99/265 (37%), Positives = 146/265 (55%), Gaps = 18/265 (6%) Query: 5 GIDMGSRSVKVVLLEQIKVEGAKAPSFAVKKAHLMLPGDLDADQAAEKAFDAALAEAGVT 64 GID+GSR K VLL + + A+ + G D A E D +A + Sbjct: 22 GIDIGSRGGKAVLLHEGHIHTAQVAT-----------GVFMQDTANELLEDILMASE-ID 69 Query: 65 RDQVKSVFATGAGRGQVAF---ATEGITEMTAGARGAVFMYPQARTVVDVGAEEGRGIKT 121 ++ + ATG GR + F AT+ +TE++ A GA F+ RT++D+G ++ + I+ Sbjct: 70 FAEIDHIVATGYGRIALEFSGIATDVVTEISCHAMGAHFLNAATRTIIDIGGQDSKAIQV 129 Query: 122 DPD-GKAIDFAGNEKCAAGAGSFAEAMSRALQLSLKEFGEASLRSDKSIPMNAQCTVFAE 180 DPD GK I F N+KCAAG G F E S L S+ E G ASLR++ +++QCTVFAE Sbjct: 130 DPDTGKVIKFLMNDKCAAGTGRFLEKASALLGFSITEVGPASLRAETVPNVSSQCTVFAE 189 Query: 181 SEVVSLIHSSTPKEDIAKAVLDAVASRVCAMVRRVGIEGNVVLIGGMGHNPGFVQSLKTA 240 SEV+SL P EDIA + A A RV +V +V +E ++V GG+ +N G +L+T Sbjct: 190 SEVISLRARGVPPEDIAAGLHFASARRVRNLVSKVPLEADLVFTGGVSNNVGMKHALETL 249 Query: 241 MDVDQVLLPELP-EFVSALGCALIA 264 + + +P+L + ALG A+ A Sbjct: 250 IGF-PITVPKLDMVYAGALGAAIYA 273 Lambda K H 0.317 0.131 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 269 Length of database: 669 Length adjustment: 32 Effective length of query: 237 Effective length of database: 637 Effective search space: 150969 Effective search space used: 150969 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory