Align Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17) (characterized)
to candidate WP_110806075.1 C8J30_RS11890 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase
Query= reanno::psRCH2:GFF2389 (257 letters) >NCBI__GCF_003217355.1:WP_110806075.1 Length = 257 Score = 140 bits (352), Expect = 3e-38 Identities = 89/259 (34%), Positives = 135/259 (52%), Gaps = 4/259 (1%) Query: 1 MTFETLLVDIQERVALITLNRPQALNALNGQLISELNQALGQLEADPQIGCIVLTGSAKA 60 M++ T+ +I E +A+ITL+RP+ +NALN + EL +AL + + + IVLTGS +A Sbjct: 1 MSYHTIRYEISEGLAVITLDRPEVMNALNAAMRRELTEALHRARGEAR--AIVLTGSGRA 58 Query: 61 FAAGADIKEMAE--LTYPQIYLDDFFADADRIATRRKPLIAAVAGYALGGGCELALLCDM 118 F +G D+ + A L + +++ I + P++AAV G A G G LAL D+ Sbjct: 59 FCSGQDLGDGAAEGLNLETVLREEYEPLLQAIYSAPLPVLAAVNGAAAGAGANLALAADV 118 Query: 119 IFAADNARFGQPEVNLGVLPGIGGTQRLTRAVGKAKAMDMCLTGRQMDAAEAERAGLVAR 178 + AA +A F Q +G++P GGT L R VG A+AM M L ++ A EA R GL+ Sbjct: 119 VIAAQSAAFMQAFTRIGLMPDAGGTWWLPRQVGMARAMGMALFAEKIGAEEAARMGLIWE 178 Query: 179 VFPAESLLEETLKAARVIAEKSLPATMMIKESVNRAFETTLAEGIRFERRVFHAVFATAD 238 P A +A+ A +K + + L + E R + +AD Sbjct: 179 AVPDVDFEHHWRARATHLAKGPTAAFAALKRAFHIGLSNPLGAQLALEARYQGELGRSAD 238 Query: 239 QKEGMAAFSEKRKPEFTNR 257 +EG+ AF EKR P+FT R Sbjct: 239 FREGVQAFLEKRPPQFTGR 257 Lambda K H 0.321 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 257 Length adjustment: 24 Effective length of query: 233 Effective length of database: 233 Effective search space: 54289 Effective search space used: 54289 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory