Align Enoyl-CoA hydratase (characterized, see rationale)
to candidate WP_110804971.1 C8J30_RS06890 3-hydroxyacyl-CoA dehydrogenase
Query= uniprot:A0A2Z5MEB0 (258 letters) >NCBI__GCF_003217355.1:WP_110804971.1 Length = 728 Score = 79.0 bits (193), Expect = 3e-19 Identities = 57/173 (32%), Positives = 84/173 (48%), Gaps = 15/173 (8%) Query: 23 KALNALNDALMDELGVALREFDADDAIGAIVLTGSEKAFAAGADIGMMSTYS-------Y 75 K++N ++ +L + AD A IVLT +K FA G D+ +++ + Sbjct: 23 KSMNVMSLEGFAQLSALVDGCLADPACKGIVLTSGKKDFAGGMDLNVIAKMRAGGAEAIF 82 Query: 76 MDVYKGDYITRNWETV----RSIR--KPIIAAVAGFALGGGCELAMMCDMIFAADT--AK 127 V + + R E ++++ KPI + G ALG G EL + C IFAA+ AK Sbjct: 83 AGVMQMHAVLRKIERAGMDPKTLKGAKPIACVLPGTALGIGLELPLSCHRIFAAENPKAK 142 Query: 128 FGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGLVSRV 180 G PEI +GI PGAGGT RL R + A L + D A+ AG++ V Sbjct: 143 IGLPEIMVGIFPGAGGTTRLVRKMGAMMAAPFLLEGKLSDPKAAKAAGIIDEV 195 Lambda K H 0.322 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 32 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 728 Length adjustment: 32 Effective length of query: 226 Effective length of database: 696 Effective search space: 157296 Effective search space used: 157296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory