Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate WP_110805439.1 C8J30_RS08590 betaine-aldehyde dehydrogenase
Query= BRENDA::P05091 (517 letters) >NCBI__GCF_003217355.1:WP_110805439.1 Length = 483 Score = 384 bits (987), Expect = e-111 Identities = 207/471 (43%), Positives = 280/471 (59%), Gaps = 6/471 (1%) Query: 40 FINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDAS 99 F+N W + + + P TGEVI + E +++A+ A+AA + W + Sbjct: 10 FVNGNWVEDAAGAEIEVIFPGTGEVIAILHEATPAVIEEALAGAQAAQRA---WAALKPV 66 Query: 100 HRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGK 159 R R+L R ADLI R LA LETLD GKP + + D L Y+AG A G+ Sbjct: 67 ERARILRRAADLIRARRAELALLETLDTGKPIQETSVADWPSGADSLEYFAGLAPTLTGE 126 Query: 160 TIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTAL 219 TIP+ GDF +YT EP+GVC I WN+P + WK PAL+TGN ++ K +E TPL AL Sbjct: 127 TIPLGGDF-AYTIREPLGVCVGIGAWNYPSQIACWKAAPALSTGNAMIFKPSEITPLGAL 185 Query: 220 YVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNL 279 +A + EAG P GV N+V G G G +A+ V KV+ TGS G + AAG+ + Sbjct: 186 QLAAIFVEAGMPAGVFNVVQGRG-AVGGRLATDSRVAKVSLTGSVPTGAKVYAAAGAG-M 243 Query: 280 KRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERS 339 K VT+ELGGKSP I+ DAD++ A+ A F++ GQ C G+R FV + I + F+ R Sbjct: 244 KHVTMELGGKSPLIVFEDADLESAIGAAMLGNFYSSGQICSNGTRVFVHKAIKERFLTRL 303 Query: 340 VARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQ 399 R + G+P D T+ GP V Q K+LGYI T K EGA+L+CGG A+ F+Q Sbjct: 304 AERTAAIKAGDPLDETTQFGPLVSAAQHAKVLGYIATAKSEGARLVCGGAAGAEGALFVQ 363 Query: 400 PTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYL 459 PTVF DV D MTIA+EE+FGPVM +L F+T +EV+ RAN + +GLAA VFT DL + + + Sbjct: 364 PTVFADVTDSMTIAREEVFGPVMAVLDFETEDEVIARANGTDFGLAAGVFTADLARGHRV 423 Query: 460 SQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTV 510 LQAGT W+N Y++ + PFG K SG GRE + ++ YT+VK V V Sbjct: 424 IAQLQAGTTWINAYNLTPVEMPFGAVKSSGVGRENSKAAIEHYTQVKAVYV 474 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 628 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 517 Length of database: 483 Length adjustment: 34 Effective length of query: 483 Effective length of database: 449 Effective search space: 216867 Effective search space used: 216867 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory