Align glutaryl-CoA dehydrogenase (EC 1.3.8.6) (characterized)
to candidate WP_110803830.1 C8J30_RS00780 isovaleryl-CoA dehydrogenase
Query= metacyc::G1G01-166-MONOMER (393 letters) >NCBI__GCF_003217355.1:WP_110803830.1 Length = 386 Score = 189 bits (480), Expect = 1e-52 Identities = 119/371 (32%), Positives = 184/371 (49%), Gaps = 5/371 (1%) Query: 19 LTEEERMVRDSAYQFAQDKLAPRVLEAFRHEQTDPAIFREMGEVGLLGATIPEQYGGSGL 78 L E+ +RD +A+D+LAP R ++ EMG +GLLG T+PE+YGG+G+ Sbjct: 10 LGEDIAALRDMVQAWARDRLAPIAARVDRDNLFPNELWPEMGALGLLGITVPEEYGGAGM 69 Query: 79 NYVCYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGTEAQKQKYLPKLASGEWIGCFG 138 Y+ + + E+ R+ + S+L + + G+ QK+KYLP L SG IG Sbjct: 70 GYLAHVVATEEIARVSASISLSYGAHSNLCVNQLKLNGSPEQKRKYLPDLVSGAKIGALA 129 Query: 139 LTEPNHGSDPGSMITRARKVDGGYRLTGSKMWITNSPIADVFVVWAKDDAG----DIRGF 194 ++E GSD M RA K Y L G K WITN AD VV+AK D G I F Sbjct: 130 MSETGAGSDVVGMKLRAEKRGDVYVLNGHKYWITNGCDADTLVVYAKTDPGAGSKGITAF 189 Query: 195 VLEKGWQGLSAPAIHGKVGLRASITGEIVMDNVFVPEENIF-PDVRGLKGPFTCLNSARY 253 ++EKG +G S K+G+R S T ++ DN VP EN+ + +G++ + L+ R Sbjct: 190 LIEKGMKGFSTSPHFDKLGMRGSNTAQLFFDNCEVPAENVLGAEGKGVRVLMSGLDYERV 249 Query: 254 GISWGALGAAEACWHTARQYTLDRQQFGRPLAANQLIQKKLADMQTEITLALQGCLRLGR 313 +S G AC Y R+QFG+P+ QL+Q K+ADM A + + Sbjct: 250 VLSGIGTGILMACLDEVVPYAQTREQFGQPIGTFQLMQAKIADMYVAANTARAYTYEVAK 309 Query: 314 MKDEGTAAVEITSIMKRNSCGKALDIARMARDMLGGNGISDEFGVARHLVNLEVVNTYEG 373 D G + + + +A+ A A LGG G ++ V+R + +++ G Sbjct: 310 ACDRGEVTRQDAAATVLYASEQAMVQAHQAVQALGGAGFLNDSTVSRLFRDAKLMEIGAG 369 Query: 374 THDVHALILGR 384 T ++ +++GR Sbjct: 370 TSEIRRMLIGR 380 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 386 Length adjustment: 30 Effective length of query: 363 Effective length of database: 356 Effective search space: 129228 Effective search space used: 129228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory