Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate WP_110806075.1 C8J30_RS11890 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase
Query= BRENDA::A4YI89 (259 letters) >NCBI__GCF_003217355.1:WP_110806075.1 Length = 257 Score = 150 bits (378), Expect = 3e-41 Identities = 96/263 (36%), Positives = 139/263 (52%), Gaps = 10/263 (3%) Query: 1 MEFETIETKKEGNLFWITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKA 60 M + TI + L ITL+RP+ +NALNA + EL A+ +A E R I++TG G+A Sbjct: 1 MSYHTIRYEISEGLAVITLDRPEVMNALNAAMRRELTEALHRARG--EARAIVLTGSGRA 58 Query: 61 FCAGADITQFNQLTPAEAWKFSKKGRE----IMDKIEALSKPTIAMINGYALGGGLELAL 116 FC+G D+ AE RE ++ I + P +A +NG A G G LAL Sbjct: 59 FCSGQDLGD----GAAEGLNLETVLREEYEPLLQAIYSAPLPVLAAVNGAAAGAGANLAL 114 Query: 117 ACDIRIAAEEAQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYG 176 A D+ IAA+ A +G+ P GGT L R +G RA+ M + ++I ++A + G Sbjct: 115 AADVVIAAQSAAFMQAFTRIGLMPDAGGTWWLPRQVGMARAMGMALFAEKIGAEEAARMG 174 Query: 177 LVNRVVPLANLEQETRKLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVF 236 L+ VP + E R A +AK + A +K + GL +PL + LALE+ G + Sbjct: 175 LIWEAVPDVDFEHHWRARATHLAKGPTAAFAALKRAFHIGLSNPLGAQLALEARYQGELG 234 Query: 237 STEDKKEGVSAFLEKREPTFKGK 259 + D +EGV AFLEKR P F G+ Sbjct: 235 RSADFREGVQAFLEKRPPQFTGR 257 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 257 Length adjustment: 24 Effective length of query: 235 Effective length of database: 233 Effective search space: 54755 Effective search space used: 54755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory