Align malonate-semialdehyde dehydrogenase (acetylating) (EC 1.2.1.18) (characterized)
to candidate WP_110806822.1 C8J30_RS15880 aldehyde dehydrogenase family protein
Query= reanno::pseudo5_N2C3_1:AO356_23175 (500 letters) >NCBI__GCF_003217355.1:WP_110806822.1 Length = 478 Score = 217 bits (552), Expect = 8e-61 Identities = 162/481 (33%), Positives = 242/481 (50%), Gaps = 14/481 (2%) Query: 10 YIDGRIQASDNARLSNVFNPATGAVQARVALAEPSTVDAAVASALAAFPAWSEQSSLRRS 69 YIDG+ + R V +P+T A ++L + + DAAV +AL A P W+ R Sbjct: 8 YIDGKWVGPEAPRDHFVIDPSTEEPCAIISLGDQADTDAAVTAALRAGPGWAATPPAERL 67 Query: 70 RVMFKFKELLDRHHDELAQIISREHGKVLSDAH-GEVTRGIEIVEYACGAPNLLKTDFSD 128 + + + +E+A +S E G + A +V GI + A + ++ Sbjct: 68 AAVERILAIYQARGEEMAAAMSLEMGAPIDFARESQVGAGIWHISNFIRAAQ--EFEWVH 125 Query: 129 NIGGGIDNWNLR-QPLGVCAGVTPFNFPV-MVPLWMIPLALVAGNCFILKPSERDPSASL 186 +G G + +P+GV +TP+N+P+ V L +IP AL+AG +LKPSE P +SL Sbjct: 126 PLGEGTPGAMIAYEPVGVVGLITPWNWPMNQVTLKVIP-ALIAGCTMVLKPSEEAPLSSL 184 Query: 187 LMARLLTEAGLPDGVFNVVQGDKVAVDALLQ-HPDIEAISFVGSTPIAEYIHQQGTAQGK 245 L A + EAG+P GVFN+V GD + V L HPD+E ISF GST + I Q A K Sbjct: 185 LFAEFVHEAGVPAGVFNLVNGDGLGVGTQLSTHPDVEMISFTGSTRAGKAISQAAAATLK 244 Query: 246 RVQALGGAKNHMIVMPDADLDQAADALIGAAYGSAGERCMAISIAVAVGDVGDELIAKLL 305 RV G K +V DAD D+A + ++G+ C A + + + D + Sbjct: 245 RVCLELGGKGANLVFADAD-DKAVARGVRHCMNNSGQSCNAPTRMLVERPLYDRAVEIAA 303 Query: 306 PRIDQLKIGNGQQPGTDMGPLVTAEHKAKVEGFIDAGVAEGARLIVDGRGFKVPGAEQGF 365 +KIG+ +PG +GP+V A K++G I+ G+ EGARL+ G G + G +GF Sbjct: 304 EVAASIKIGSAHEPGRHIGPVVNAAQFEKIQGLIETGIKEGARLVAGGLG-RPEGLNKGF 362 Query: 366 FVGATLFDQVTAEMSIYQQEIFGPVLGIVRVPDFATAVALINAHEFGNGVSCFTRDGGIA 425 F+ T+F VT EM++ ++EIFGPVL I+ A AV + NA +G ++DG Sbjct: 363 FIRPTVFADVTPEMTVMREEIFGPVLSIMPFDTEAEAVEIANATPYGLTNYVQSQDGARR 422 Query: 426 RAFARSIKVGMVGINVPIPVPMAWHSFGGWKRSLFGDHHAYGEEGLRFYSRYKSVMQRWP 485 AR ++ GMV +N A FGG + S G G G+ + KS+ W Sbjct: 423 NRLARLLRSGMVEMNG--QSRGAGAPFGGVRAS--GRAREGGRWGIEEFCEVKSI-SGWA 477 Query: 486 D 486 D Sbjct: 478 D 478 Lambda K H 0.320 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 521 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 500 Length of database: 478 Length adjustment: 34 Effective length of query: 466 Effective length of database: 444 Effective search space: 206904 Effective search space used: 206904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory