Align Spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein, component of The spermidine/putrescine uptake porter, PotABCD (characterized)
to candidate WP_110806537.1 C8J30_RS14400 spermidine/putrescine ABC transporter substrate-binding protein
Query= TCDB::Q97Q45 (356 letters) >NCBI__GCF_003217355.1:WP_110806537.1 Length = 340 Score = 192 bits (489), Expect = 8e-54 Identities = 107/305 (35%), Positives = 163/305 (53%), Gaps = 5/305 (1%) Query: 31 SRDSQKLVIYNWGDYIDPELLTQFTEETGIQVQYETFDSNEAMYTKIKQGGTTYDIAIPS 90 +R + L +YNWGDYI+P +LT+FTEETGI+V +T+ +NE M KI+ G T YDI PS Sbjct: 18 ARAEETLALYNWGDYINPAVLTKFTEETGIKVTLDTYSANEEMLAKIQAGATGYDIVFPS 77 Query: 91 EYMINKMKDEDLLVPLDYSKIEGIENIGPEFLNQSFDPGNKFSIPYFWGTLGIVYNETMV 150 +M + M DLL + + NI P FL DP + + +PY WGT+GI YNE + Sbjct: 78 VWMQDIMVKLDLLEQTNINADPAFANIDPAFLRSKEDPQSSYCLPYAWGTVGIFYNENVT 137 Query: 151 DEAPEHWDDLWKPEYK--NSIMLFDGAREVLGLGLNSLGYSLNSKDLQQLEETVDKLYKL 208 WDD + K I L D REVLG+GL G+S+NS D +L+E D + Sbjct: 138 GPI-AGWDDFFAIPQKTGQKITLLDDMREVLGMGLIMTGHSVNSTDPAELKEAADYVTAH 196 Query: 209 TPNIKAIVADEMKGYMIQNNVAIGVTFSGEASQMLEKNENLRYVVPTEASNLWFDNMVIP 268 + A + M ++ +VA F G + + ++Y++P E + ++ +N+ + Sbjct: 197 KAEVTAFTYESMP-LLLSGDVAAAHYFVG-GNMFFVDHPEIKYIIPKEGATMYQENICVL 254 Query: 269 KTVKNQNSAYAFINFMLKPENALQNAEYVGYSTPNLPAKELLPEETKEDKAFYPDVETMK 328 K ++ +A F+ F L+PE A N TPN PA +L P+ K + ET+ Sbjct: 255 KDAPHKEAAQKFLQFYLRPEIAALNVSQQFNGTPNRPANDLTPDFIKSNPNINVPAETLA 314 Query: 329 HLEVY 333 L+++ Sbjct: 315 RLQIF 319 Lambda K H 0.316 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 340 Length adjustment: 29 Effective length of query: 327 Effective length of database: 311 Effective search space: 101697 Effective search space used: 101697 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory