Align Fructose import permease protein FrcC (characterized)
to candidate WP_110806514.1 C8J30_RS14100 ABC transporter permease
Query= SwissProt::Q9F9B1 (360 letters) >NCBI__GCF_003217355.1:WP_110806514.1 Length = 339 Score = 148 bits (374), Expect = 2e-40 Identities = 99/321 (30%), Positives = 159/321 (49%), Gaps = 30/321 (9%) Query: 52 LIVLVLSLIAFGVILGGKFF--SAFTMTLILQQVAIVGIVGAAQTLVILTAGIDLSVGAI 109 L+ + L G I G+ F S + +++ QV+++GI+ T VI+ GIDLS G+ Sbjct: 28 LVGIALVFEILGWIFQGQSFLMSIDRLKIMILQVSVIGIISVGVTQVIIAGGIDLSSGS- 86 Query: 110 MVLSSVIMGQFTFRY-------------GFPPALSVICGLGVGALCGYINGTLVARMKLP 156 V+ +V M +F P + + GL GAL G ING L+A K+P Sbjct: 87 -VVGAVAMFAMSFAQVSTYARAVYPDLTDLPAIVPIALGLMAGALVGLINGALIAYAKIP 145 Query: 157 PFIVTLGMWQIVLASNFLYSANETIRAQDISANASILQFFGQNFRIGNAVFTYGVVVMVL 216 PFI TLG +V A F A + Q IS F G+ V + + Sbjct: 146 PFIATLGT--MVTARGF---AKWYTKGQPISFPTDDFAFIGKGMM--------PVAIFLA 192 Query: 217 LVCLLWYVLNRTAWGRYVYAVGDDPEAAKLAGVNVTRMLISIYTLSGLICALAGWALIGR 276 + + + T +G++ YA+G + +AA+++G+NV LI +Y ++ + ALAG + R Sbjct: 193 VAAIFHVAMKYTRYGKFTYAIGANQQAARVSGINVEHHLIKVYVVAATLAALAGMVVAAR 252 Query: 277 IGSVSPTAGQFANIESITAVVIGGISLFGGRGSIMGMLFGALIVGVFSLGLRLMGTDPQW 336 + G +++I VIGG+SL GGRGSI+G + G +I GV G + D + Sbjct: 253 GQTAQAGMGLAYELDAIAMAVIGGVSLTGGRGSILGTMIGMVIFGVIISGFTFLRLDAYY 312 Query: 337 TYLLIGLLIIIAVAIDQWIRK 357 ++ G++I+ AV D + +K Sbjct: 313 QEMIKGVIIVAAVVADVYRQK 333 Lambda K H 0.327 0.141 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 339 Length adjustment: 29 Effective length of query: 331 Effective length of database: 310 Effective search space: 102610 Effective search space used: 102610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory