Align Inner membrane ABC transporter permease protein (characterized, see rationale)
to candidate WP_110804034.1 C8J30_RS01980 carbohydrate ABC transporter permease
Query= uniprot:A8LLL4 (385 letters) >NCBI__GCF_003217355.1:WP_110804034.1 Length = 382 Score = 468 bits (1204), Expect = e-136 Identities = 240/384 (62%), Positives = 291/384 (75%), Gaps = 10/384 (2%) Query: 2 DNIAGSKSSLTWAVQLSVVGLVVLWLLPTFGLFVSSFRTVEQISSSGWWKAMFPSEQNLT 61 D AG ++L WAV ++ LV+LW +PT GL VSSFR +QI +SGWW+A F S N Sbjct: 7 DGAAGRSAALVWAVNIAAAALVLLWTIPTVGLLVSSFRDRDQIITSGWWRAAFSSTANDF 66 Query: 62 LRAADPDDFRMPQGDLFVVKGNLFEDEGISEAEISVWGTSSRDVAAYTAGETADLGDGET 121 +RA D ++ +GD+FV+ GN+ S+AE+ WG SS+ AAY G+ A+L DG+ Sbjct: 67 VRAGTAAD-QVQEGDVFVISGNVLP----SKAELKSWGVSSKAPAAYQPGDIAELKDGQR 121 Query: 122 ITVQSNGAYVWSGTDDQISGRGQRVFVTATTPPEFTFANYENMLLDPNNSEGMARAFFNT 181 +TV G Y + GRG R+FVT PP T NY ++ +EG+ RAF NT Sbjct: 122 LTVSDKGDYRLTSPTAFPEGRGMRIFVTTVAPPRLTTGNYARVI----TAEGIGRAFLNT 177 Query: 182 LTVTIPATIIPILVAAFAAYALAWMEFPGRALLIALIVGLLVVPLQLALIPLLTLHNAIG 241 +TVTIPAT+IPIL+AAFAAYALAWM FPGRALL+A IVGLLVVPLQLALIPLL LHN IG Sbjct: 178 MTVTIPATVIPILIAAFAAYALAWMRFPGRALLVATIVGLLVVPLQLALIPLLKLHNQIG 237 Query: 242 IGKGYLGTWLAHTGFGMPLAIYLLRNYMVGLPRDIIENAKVDGATDFQIFTKIVLPLSFP 301 + + YLG WLAHTGFG+PLAIYLLRNYMVGLPR+IIE+A+VDGAT+FQIF +IVLPLSFP Sbjct: 238 LNQSYLGIWLAHTGFGLPLAIYLLRNYMVGLPREIIESARVDGATEFQIFRRIVLPLSFP 297 Query: 302 ALASFAIFQFLWTWNDLLVAKVFLIDATGQTTVMTNQIVELLGTRGGNWEILATAAFVSI 361 ALASFAIFQFLW WNDLLVA VFL +AT T VMT + LLG+RGG+WEILA +AFVSI Sbjct: 298 ALASFAIFQFLWVWNDLLVATVFLGNAT-DTQVMTGALRALLGSRGGDWEILAASAFVSI 356 Query: 362 AVPLLVFFSMQRFLVRGLLAGSVK 385 AVPL+VFF++Q++LVRGLLAGSVK Sbjct: 357 AVPLIVFFALQKYLVRGLLAGSVK 380 Lambda K H 0.323 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 462 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 382 Length adjustment: 30 Effective length of query: 355 Effective length of database: 352 Effective search space: 124960 Effective search space used: 124960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory